BLASTX nr result
ID: Paeonia25_contig00050708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050708 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517398.1| hypothetical protein RCOM_0852460 [Ricinus c... 57 2e-06 >ref|XP_002517398.1| hypothetical protein RCOM_0852460 [Ricinus communis] gi|223543409|gb|EEF44940.1| hypothetical protein RCOM_0852460 [Ricinus communis] Length = 600 Score = 57.4 bits (137), Expect = 2e-06 Identities = 42/86 (48%), Positives = 51/86 (59%), Gaps = 7/86 (8%) Frame = -3 Query: 237 MPQYPLYSSGLELTNLVLASGLPQRSWAAI----KDPNPNGQPSLAPSVRVRVH-PQSPT 73 M Q PL++SGLEL NL + S L S AI + +PN Q + S+R + QS T Sbjct: 1 MSQLPLFNSGLELANLAVNSNLLHLSLNAIYTLQSEADPNQQQRQSLSLRWKFEKQQSNT 60 Query: 72 IIAIVTSH--TAHNLQEDMDLVSSAT 1 IIA VTS T H+LQE DLVSSAT Sbjct: 61 IIAFVTSPCCTVHHLQEGADLVSSAT 86