BLASTX nr result
ID: Paeonia25_contig00050544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050544 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428215.1| hypothetical protein CICLE_v10027542mg [Citr... 61 1e-07 ref|XP_006428212.1| hypothetical protein CICLE_v10027310mg [Citr... 60 3e-07 ref|XP_006428210.1| hypothetical protein CICLE_v10027432mg [Citr... 60 3e-07 ref|XP_006428181.1| hypothetical protein CICLE_v10027431mg [Citr... 60 3e-07 ref|XP_006379085.1| hypothetical protein POPTR_0009s06240g [Popu... 56 6e-06 >ref|XP_006428215.1| hypothetical protein CICLE_v10027542mg [Citrus clementina] gi|557530205|gb|ESR41455.1| hypothetical protein CICLE_v10027542mg [Citrus clementina] Length = 111 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/63 (55%), Positives = 41/63 (65%), Gaps = 4/63 (6%) Frame = -1 Query: 375 MSVSIEALAMAGADYLQCNMDMEELER--DWPPPHLLADEEEAE--YGHPNTHISHDSRN 208 M VS+EALAM GADY++ MD EE ER D PPHLLA+EEE E P+TH S D + Sbjct: 1 MLVSLEALAMTGADYVEWGMDAEEWERDDDLTPPHLLAEEEEEEEHSALPSTHFSEDEDD 60 Query: 207 SSS 199 S Sbjct: 61 CDS 63 >ref|XP_006428212.1| hypothetical protein CICLE_v10027310mg [Citrus clementina] gi|557530202|gb|ESR41452.1| hypothetical protein CICLE_v10027310mg [Citrus clementina] Length = 125 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/59 (57%), Positives = 42/59 (71%), Gaps = 5/59 (8%) Frame = -1 Query: 375 MSVSIEALAMAGADYLQCNMDMEELERD----WPPPHLLADEEE-AEYGHPNTHISHDS 214 MSVS+EALAMAGADY + +D+EE ER+ PPPHLLA+EEE EY +H S D+ Sbjct: 1 MSVSVEALAMAGADYHESGIDVEEWEREDIELEPPPHLLANEEEKEEYLSVASHFSEDN 59 >ref|XP_006428210.1| hypothetical protein CICLE_v10027432mg [Citrus clementina] gi|557530200|gb|ESR41450.1| hypothetical protein CICLE_v10027432mg [Citrus clementina] Length = 112 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 5/59 (8%) Frame = -1 Query: 375 MSVSIEALAMAGADYLQCNMDMEELERD----WPPPHLLADEEE-AEYGHPNTHISHDS 214 MSVS+EALAMAGAD + MD+EE ER+ PPPHLLADEEE EY +H S D+ Sbjct: 1 MSVSMEALAMAGADCYEWGMDVEEWEREDIELEPPPHLLADEEEKEEYLSTASHFSEDN 59 >ref|XP_006428181.1| hypothetical protein CICLE_v10027431mg [Citrus clementina] gi|557530171|gb|ESR41421.1| hypothetical protein CICLE_v10027431mg [Citrus clementina] Length = 112 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 5/59 (8%) Frame = -1 Query: 375 MSVSIEALAMAGADYLQCNMDMEELERD----WPPPHLLADEEE-AEYGHPNTHISHDS 214 MSVS+EALAMAGAD + MD+EE ER+ PPPHLLADEEE EY +H S D+ Sbjct: 1 MSVSMEALAMAGADCYEWGMDVEEWEREDVELEPPPHLLADEEEKEEYLSTASHFSEDN 59 >ref|XP_006379085.1| hypothetical protein POPTR_0009s06240g [Populus trichocarpa] gi|550331148|gb|ERP56882.1| hypothetical protein POPTR_0009s06240g [Populus trichocarpa] Length = 103 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (6%) Frame = -1 Query: 375 MSVSIEALAMAGADYLQCNMDMEELER---DWPPPHLLADEEE 256 MS SIEALAMAG DYL N+D+EE E+ + PPPHLLA+EEE Sbjct: 1 MSASIEALAMAGVDYLIHNLDIEEWEQEELELPPPHLLAEEEE 43