BLASTX nr result
ID: Paeonia25_contig00050513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050513 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM00274.1| predicted protein [Fibroporia radiculosa] 61 1e-07 gb|EPS95197.1| hypothetical protein FOMPIDRAFT_139332 [Fomitopsi... 55 8e-06 >emb|CCM00274.1| predicted protein [Fibroporia radiculosa] Length = 1202 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/42 (73%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -2 Query: 144 PPDIESNPPPAVSSLRSRFEKLAAD-SSRVIPQRPTSSYGYL 22 PPDIES PPPAVSSLRSRFE+LAAD +S++ +RP SSYG L Sbjct: 3 PPDIESTPPPAVSSLRSRFEQLAADTASQLTTKRPMSSYGLL 44 >gb|EPS95197.1| hypothetical protein FOMPIDRAFT_139332 [Fomitopsis pinicola FP-58527 SS1] Length = 982 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = -2 Query: 150 STPPDIESNPPPAVSSLRSRFEKLAADSSRVIP--QRPTSSYGYL 22 S PDIES PPPAVSSLRSRFE+LAA+S+ P +RP S++G L Sbjct: 6 SNSPDIESTPPPAVSSLRSRFEQLAANSNSPAPGQKRPLSTHGLL 50