BLASTX nr result
ID: Paeonia25_contig00050485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050485 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 54 3e-07 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 53.9 bits (128), Expect(2) = 3e-07 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = -3 Query: 262 EESIDHWFLNCPFFMKLWQKRWVGFGRSD*IQDFMSSLPSEDISVIRMKDITP--WKIVV 89 EES+DH FL+CPF + LW W G I S D V + +T W +V Sbjct: 174 EESVDHLFLHCPFSLSLWWLLWREVGTVWVIPKGCSDFLCSDFVVWGLGKLTSTLWGCLV 233 Query: 88 LSIC*TFWMI*MERSKRVFED 26 S+ FW+I MER++R+FED Sbjct: 234 HSV---FWIIWMERNRRIFED 251 Score = 26.2 bits (56), Expect(2) = 3e-07 Identities = 10/36 (27%), Positives = 24/36 (66%) Frame = -1 Query: 384 IEIKMFFLATRKINANDMRQKEKRKHGHFPNPQWCV 277 +++ ++ +A K+N +D+ Q+ ++ + +PQWCV Sbjct: 135 VKVFVWLVALGKVNTSDLVQR--KRPFMYLSPQWCV 168