BLASTX nr result
ID: Paeonia25_contig00050441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050441 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165407.1| PREDICTED: flavonoid 3'-monooxygenase-like [... 55 8e-06 >ref|XP_004165407.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus] Length = 516 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 106 SPLANLLHGFVCELAGDVNREELNMEEIFGLSTPK 2 S LANLLHGF +L GD+ +E+LNMEEIFGLSTPK Sbjct: 462 STLANLLHGFNWKLPGDMEKEDLNMEEIFGLSTPK 496