BLASTX nr result
ID: Paeonia25_contig00050397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050397 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002472981.1| predicted protein [Postia placenta Mad-698-R... 72 8e-11 gb|EMD39759.1| hypothetical protein CERSUDRAFT_112042 [Ceriporio... 70 2e-10 emb|CCM04930.1| predicted protein [Fibroporia radiculosa] 69 7e-10 gb|EIW59133.1| hypothetical protein TRAVEDRAFT_71313 [Trametes v... 64 3e-08 ref|XP_007399395.1| hypothetical protein PHACADRAFT_261815 [Phan... 56 5e-06 >ref|XP_002472981.1| predicted protein [Postia placenta Mad-698-R] gi|220727891|gb|EED81797.1| predicted protein [Postia placenta Mad-698-R] Length = 495 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 6 VLPDQLEYFVLQPPPTAVSDFYCSCCMEHRGDADVMRVFDA 128 VLP +++ FV+QPPPTA SDFYCSCCM+ RGDADVMRVF+A Sbjct: 306 VLPARVQRFVIQPPPTAPSDFYCSCCMDVRGDADVMRVFEA 346 >gb|EMD39759.1| hypothetical protein CERSUDRAFT_112042 [Ceriporiopsis subvermispora B] Length = 478 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 15 DQLEYFVLQPPPTAVSDFYCSCCMEHRGDADVMRVFDA 128 D LE FVLQPPPTA++DF+CSCCME RGD DV+RVFDA Sbjct: 330 DSLERFVLQPPPTALTDFFCSCCMELRGDVDVLRVFDA 367 >emb|CCM04930.1| predicted protein [Fibroporia radiculosa] Length = 454 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 6 VLPDQLEYFVLQPPPTAVSDFYCSCCMEHRGDADVMRVFDA 128 V+P ++ FV+ PPPT VSDFYCSCCM+ RGDADVMRVF+A Sbjct: 303 VVPASVQRFVIAPPPTGVSDFYCSCCMDVRGDADVMRVFEA 343 >gb|EIW59133.1| hypothetical protein TRAVEDRAFT_71313 [Trametes versicolor FP-101664 SS1] Length = 447 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 6 VLP--DQLEYFVLQPPPTAVSDFYCSCCMEHRGDADVMRVFDA 128 VLP + LE FV QPPP + +DFYCSCCM+ RGD DVMRVF+A Sbjct: 311 VLPPAETLELFVFQPPPVSNTDFYCSCCMDARGDRDVMRVFEA 353 >ref|XP_007399395.1| hypothetical protein PHACADRAFT_261815 [Phanerochaete carnosa HHB-10118-sp] gi|409042100|gb|EKM51584.1| hypothetical protein PHACADRAFT_261815 [Phanerochaete carnosa HHB-10118-sp] Length = 384 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +3 Query: 6 VLPDQLEYFVLQPPPTAVSDFYCSCCMEHRGDADVMRVFD 125 +LPD L +F +QP PT S FYCSCCM+ RGD DVMR+ + Sbjct: 244 LLPDGLRFFAIQPSPT--STFYCSCCMDLRGDVDVMRILE 281