BLASTX nr result
ID: Paeonia25_contig00050360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050360 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa] 57 3e-06 >gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa] Length = 1384 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 15/61 (24%) Frame = +2 Query: 2 KHLEVDYHYI---------------TKDQVADIFTKGLSRQRFQMLQSKLMVLLLPIRLW 136 KH+EVDYHY+ T DQ ADIFTKGLS QRFQ L SKL V P+ L Sbjct: 1314 KHIEVDYHYVRDKVVRQELAVSYVSTADQTADIFTKGLSTQRFQFLASKLPVRARPLSLR 1373 Query: 137 G 139 G Sbjct: 1374 G 1374