BLASTX nr result
ID: Paeonia25_contig00050314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050314 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007049393.1| Uncharacterized protein TCM_002441 [Theobrom... 64 2e-08 ref|XP_002265233.1| PREDICTED: uncharacterized protein LOC100256... 62 6e-08 ref|XP_003556896.2| PREDICTED: uncharacterized protein LOC100804... 61 2e-07 ref|XP_007163984.1| hypothetical protein PHAVU_L0005000g, partia... 60 3e-07 ref|XP_004303578.1| PREDICTED: uncharacterized protein LOC101311... 60 3e-07 ref|XP_003542189.1| PREDICTED: uncharacterized protein LOC100802... 60 3e-07 ref|XP_002532211.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_006357660.1| PREDICTED: uncharacterized protein LOC102603... 56 5e-06 ref|XP_004243587.1| PREDICTED: uncharacterized protein LOC101264... 55 8e-06 >ref|XP_007049393.1| Uncharacterized protein TCM_002441 [Theobroma cacao] gi|508701654|gb|EOX93550.1| Uncharacterized protein TCM_002441 [Theobroma cacao] Length = 429 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = -2 Query: 258 FWLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPDQE 142 FWLLPLSL+PFLGPALYLVLRPS+S +PV+++P + +Q+ Sbjct: 391 FWLLPLSLVPFLGPALYLVLRPSLSELPVTVSPTSSEQK 429 >ref|XP_002265233.1| PREDICTED: uncharacterized protein LOC100256200 [Vitis vinifera] gi|296085052|emb|CBI28467.3| unnamed protein product [Vitis vinifera] Length = 327 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPDQE 142 WLLPLSL+PFLGPALYL+LRPS+S +PVSL+P + +Q+ Sbjct: 290 WLLPLSLVPFLGPALYLLLRPSLSAMPVSLSPSSSEQK 327 >ref|XP_003556896.2| PREDICTED: uncharacterized protein LOC100804721 [Glycine max] Length = 375 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPD 148 WLLPLSLIPFLGP LYL+LRPS+ST+ +S TP+ P+ Sbjct: 340 WLLPLSLIPFLGPGLYLLLRPSLSTVAISQTPVEPE 375 >ref|XP_007163984.1| hypothetical protein PHAVU_L0005000g, partial [Phaseolus vulgaris] gi|593731611|ref|XP_007163993.1| hypothetical protein PHAVU_L0003000g, partial [Phaseolus vulgaris] gi|561039884|gb|ESW35978.1| hypothetical protein PHAVU_L0005000g, partial [Phaseolus vulgaris] gi|561039897|gb|ESW35987.1| hypothetical protein PHAVU_L0003000g, partial [Phaseolus vulgaris] Length = 158 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPD 148 WLLP+SLIPFLGP LYL+LRPS+ST+ +S TP+ P+ Sbjct: 123 WLLPISLIPFLGPGLYLLLRPSLSTVAISQTPVEPE 158 >ref|XP_004303578.1| PREDICTED: uncharacterized protein LOC101311881 [Fragaria vesca subsp. vesca] Length = 331 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPD 148 WLLPLS++PFLGPALYL+LRPS+ST P SL+P P+ Sbjct: 296 WLLPLSVVPFLGPALYLILRPSLSTKPNSLSPAEPE 331 >ref|XP_003542189.1| PREDICTED: uncharacterized protein LOC100802797 [Glycine max] Length = 331 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPD 148 WLLP+SLIPFLGP LYL+LRPS+ST+ +S TP+ P+ Sbjct: 296 WLLPISLIPFLGPGLYLLLRPSLSTVAISQTPVEPE 331 >ref|XP_002532211.1| conserved hypothetical protein [Ricinus communis] gi|223528107|gb|EEF30180.1| conserved hypothetical protein [Ricinus communis] Length = 331 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPDQ 145 WLLP+SL+PFLGPALYLVLRPS+S +PVS++P + + Sbjct: 295 WLLPISLVPFLGPALYLVLRPSLSEMPVSVSPTSEQE 331 >ref|XP_006357660.1| PREDICTED: uncharacterized protein LOC102603098 [Solanum tuberosum] Length = 337 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPDQE 142 WLLPLS+IPFLGPALYL+LRPS+ T+P +P + +++ Sbjct: 300 WLLPLSVIPFLGPALYLLLRPSIPTVPALSSPTSTEEK 337 >ref|XP_004243587.1| PREDICTED: uncharacterized protein LOC101264343 [Solanum lycopersicum] Length = 336 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 255 WLLPLSLIPFLGPALYLVLRPSVSTIPVSLTPLAPDQE 142 WLLPLS+IPFLGPALYL+LRPS+ T+P +P + +++ Sbjct: 299 WLLPLSVIPFLGPALYLLLRPSLPTVPALSSPTSTEEK 336