BLASTX nr result
ID: Paeonia25_contig00050050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050050 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007360539.1| hypothetical protein DICSQDRAFT_131382 [Dich... 67 3e-09 >ref|XP_007360539.1| hypothetical protein DICSQDRAFT_131382 [Dichomitus squalens LYAD-421 SS1] gi|395334733|gb|EJF67109.1| hypothetical protein DICSQDRAFT_131382 [Dichomitus squalens LYAD-421 SS1] Length = 75 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 211 MTNYIIRLNNHLQAQNALHTLSWVPEQTGRGQSMQWKVTCKINGEVKGVGI 363 MT Y + LNN+LQ Q LH L W E G +WKVTC INGEVKGVGI Sbjct: 1 MTRYAVELNNYLQRQGQLHALHWGEEHIGPAGKKEWKVTCNINGEVKGVGI 51