BLASTX nr result
ID: Paeonia25_contig00049504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00049504 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007370457.1| hypothetical protein DICSQDRAFT_140907 [Dich... 61 1e-07 gb|EMD32319.1| hypothetical protein CERSUDRAFT_119018 [Ceriporio... 58 1e-06 >ref|XP_007370457.1| hypothetical protein DICSQDRAFT_140907 [Dichomitus squalens LYAD-421 SS1] gi|395324335|gb|EJF56777.1| hypothetical protein DICSQDRAFT_140907 [Dichomitus squalens LYAD-421 SS1] Length = 452 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/72 (45%), Positives = 39/72 (54%) Frame = +2 Query: 2 PPPPSSGQPTYAGFVSDRLVLSWYTSYATRTPSLQRFXXXXXXXXXXXXXXXXXXVVAAR 181 P S P+Y G VSDR +L+W T+YA RTP L RF VVAA+ Sbjct: 174 PSTDPSSPPSYLGLVSDRALLAWLTAYAQRTPPLLRFLSVPLSAVALPSLYLYAAVVAAK 233 Query: 182 AGDTVLEAMRLM 217 A D VL+AMRLM Sbjct: 234 ASDKVLDAMRLM 245 >gb|EMD32319.1| hypothetical protein CERSUDRAFT_119018 [Ceriporiopsis subvermispora B] Length = 434 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = +2 Query: 5 PPPSSGQPTYAGFVSDRLVLSWYTSYATRTPSLQRFXXXXXXXXXXXXXXXXXXVVAARA 184 PPPS+ ++ G +SDR +L+W+ +YA +TPSL RF VVAA+A Sbjct: 174 PPPSN---SFLGMISDRQLLAWFMNYAQQTPSLLRFITNPLHSLALPSLYLYMSVVAAKA 230 Query: 185 GDTVLEAMRLM 217 D+VL+AMRLM Sbjct: 231 TDSVLDAMRLM 241