BLASTX nr result
ID: Paeonia25_contig00049427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00049427 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW59376.1| hypothetical protein TRAVEDRAFT_71466 [Trametes v... 56 5e-06 >gb|EIW59376.1| hypothetical protein TRAVEDRAFT_71466 [Trametes versicolor FP-101664 SS1] Length = 310 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/96 (33%), Positives = 48/96 (50%) Frame = +2 Query: 14 MRHRGFEASIQCEKKTLEEYSVEVEGPGKIASWVPSEVGKTFTIHIADLRTRSPSAYQTK 193 ++H G+ A I+CE K LE Y V VE ++ WV SE GKTF+IH D S + + Sbjct: 3 LQHNGYSAYIKCEGKELEVYGVSVEDEKTVSCWVASEDGKTFSIHWGD--DSSKTFMEVT 60 Query: 194 VYVDGVRVALKCRGPGQHQTTMTVHTAGNKTAPLLF 301 +DG RV + + + V ++ L+F Sbjct: 61 TRIDGPRVNVYAHKANREGCFIGVREGTDRRRELVF 96