BLASTX nr result
ID: Paeonia25_contig00049068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00049068 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT02535.1| hypothetical protein FOMPIDRAFT_147509 [Fomitopsi... 67 3e-09 ref|XP_007366554.1| hypothetical protein DICSQDRAFT_62181 [Dicho... 66 4e-09 ref|XP_002472156.1| predicted protein [Postia placenta Mad-698-R... 65 1e-08 ref|XP_007316314.1| hypothetical protein SERLADRAFT_367749 [Serp... 57 2e-06 gb|EGO00583.1| hypothetical protein SERLA73DRAFT_30457 [Serpula ... 57 2e-06 emb|CCM01015.1| predicted protein [Fibroporia radiculosa] 57 3e-06 ref|XP_007262269.1| hypothetical protein FOMMEDRAFT_144281 [Fomi... 57 3e-06 ref|XP_007385922.1| Dbl domain-containing protein, partial [Punc... 57 3e-06 >gb|EPT02535.1| hypothetical protein FOMPIDRAFT_147509 [Fomitopsis pinicola FP-58527 SS1] Length = 989 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEK 189 LWD+LKV+ EMNAG+AET+RVWWSR+A+ E+ + LN VR PEK Sbjct: 606 LWDSLKVEEEMNAGAAETVRVWWSRWADIEAQLLGLNIVRSPEK 649 >ref|XP_007366554.1| hypothetical protein DICSQDRAFT_62181 [Dichomitus squalens LYAD-421 SS1] gi|395328324|gb|EJF60717.1| hypothetical protein DICSQDRAFT_62181 [Dichomitus squalens LYAD-421 SS1] Length = 939 Score = 66.2 bits (160), Expect = 4e-09 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 8/62 (12%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEK----DKDK----KPRL 165 LWDALKVD E N G++ETLRVWW RFAE E I LN VR EK DK + KPRL Sbjct: 558 LWDALKVDEEANQGASETLRVWWGRFAEVEVQIQDLNIVRPLEKKTTPDKQRTRPSKPRL 617 Query: 164 SD 159 S+ Sbjct: 618 SE 619 >ref|XP_002472156.1| predicted protein [Postia placenta Mad-698-R] gi|220728714|gb|EED82602.1| predicted protein [Postia placenta Mad-698-R] Length = 1102 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEK 189 LWD LKV+GEMNAG+ ET+RVW SRF +AE+ I LN +R PEK Sbjct: 717 LWDGLKVEGEMNAGAVETVRVWGSRFVDAETNILGLNIIRPPEK 760 >ref|XP_007316314.1| hypothetical protein SERLADRAFT_367749 [Serpula lacrymans var. lacrymans S7.9] gi|336384994|gb|EGO26141.1| hypothetical protein SERLADRAFT_367749 [Serpula lacrymans var. lacrymans S7.9] Length = 909 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEKDKDKKP 171 LWDAL+V+GE NAG+ ETLRVWW R+A+AE I +N + P+K ++P Sbjct: 550 LWDALRVEGERNAGADETLRVWWERWADAERRILDMNII-NPKKVYVERP 598 >gb|EGO00583.1| hypothetical protein SERLA73DRAFT_30457 [Serpula lacrymans var. lacrymans S7.3] Length = 830 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEKDKDKKP 171 LWDAL+V+GE NAG+ ETLRVWW R+A+AE I +N + P+K ++P Sbjct: 471 LWDALRVEGERNAGADETLRVWWERWADAERRILDMNII-NPKKVYVERP 519 >emb|CCM01015.1| predicted protein [Fibroporia radiculosa] Length = 1105 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEKDKDKKPRL 165 LW+ALKV EMNAG+ ET+RVWWSRF E ++ + +N +R+ + + P+L Sbjct: 711 LWNALKVGDEMNAGAPETVRVWWSRFEETDARLLGMNIIRR----RSESPKL 758 >ref|XP_007262269.1| hypothetical protein FOMMEDRAFT_144281 [Fomitiporia mediterranea MF3/22] gi|393222833|gb|EJD08317.1| hypothetical protein FOMMEDRAFT_144281 [Fomitiporia mediterranea MF3/22] Length = 909 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 3/67 (4%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEKDKDKKP---RLSDVGT 150 LWD L+++GE NAG ETL +WW+R++E E IS L +++ + + P R SDV + Sbjct: 528 LWDCLRMEGETNAGCVETLTLWWTRYSEVEDAISRLTILKREKPVYPRSPARSRASDVSS 587 Query: 149 KHRAKSL 129 + SL Sbjct: 588 MDYSSSL 594 >ref|XP_007385922.1| Dbl domain-containing protein, partial [Punctularia strigosozonata HHB-11173 SS5] gi|390597041|gb|EIN06441.1| Dbl domain-containing protein, partial [Punctularia strigosozonata HHB-11173 SS5] Length = 466 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -1 Query: 320 LWDALKVDGEMNAGSAETLRVWWSRFAEAESLISALNSVRQPEKDKDKKPRLS 162 LWDAL+++ E N G+ ET+RVWW+RFAE E ++ LN V + +D PRL+ Sbjct: 411 LWDALRIEDEANNGADETIRVWWNRFAEVEGDVNMLNIVNPQKLHED--PRLT 461