BLASTX nr result
ID: Paeonia25_contig00049058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00049058 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31326.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002275897.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 emb|CAN65544.1| hypothetical protein VITISV_018576 [Vitis vinifera] 55 8e-06 >emb|CBI31326.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -1 Query: 251 RMSTIFCEVRVLKVGKDIHGYVLKKDYENIAFVFA*IVKMYG 126 R+ +I E+RVLK+GK+IHG +LKKD+E+I FV A I+KMYG Sbjct: 333 RILSICGELRVLKLGKEIHGQILKKDFESIPFVSAEIIKMYG 374 >ref|XP_002275897.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71460, chloroplastic-like [Vitis vinifera] Length = 725 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -1 Query: 251 RMSTIFCEVRVLKVGKDIHGYVLKKDYENIAFVFA*IVKMYG 126 R+ +I E+RVLK+GK+IHG +LKKD+E+I FV A I+KMYG Sbjct: 563 RILSICGELRVLKLGKEIHGQILKKDFESIPFVSAEIIKMYG 604 >emb|CAN65544.1| hypothetical protein VITISV_018576 [Vitis vinifera] Length = 664 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -1 Query: 251 RMSTIFCEVRVLKVGKDIHGYVLKKDYENIAFVFA*IVKMYG 126 R+ +I E+RVLK+GK+IHG +LKKD+E+I FV A I+KMYG Sbjct: 502 RILSICGELRVLKLGKEIHGQILKKDFESIPFVSAEIIKMYG 543