BLASTX nr result
ID: Paeonia25_contig00048853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00048853 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267994.2| PREDICTED: uncharacterized protein LOC100261... 59 5e-07 emb|CBI17700.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002298592.1| hypothetical protein POPTR_0001s36260g [Popu... 57 8e-07 >ref|XP_002267994.2| PREDICTED: uncharacterized protein LOC100261110 [Vitis vinifera] Length = 528 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 AESELKRLRQSLCFKARPLPDFYRKREASKNQTK 104 AESEL++LRQ+LCFKARPLPDFY++RE K QTK Sbjct: 407 AESELRKLRQTLCFKARPLPDFYKERETLKGQTK 440 >emb|CBI17700.3| unnamed protein product [Vitis vinifera] Length = 567 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 AESELKRLRQSLCFKARPLPDFYRKREASKNQTK 104 AESEL++LRQ+LCFKARPLPDFY++RE K QTK Sbjct: 446 AESELRKLRQTLCFKARPLPDFYKERETLKGQTK 479 >ref|XP_002298592.1| hypothetical protein POPTR_0001s36260g [Populus trichocarpa] gi|222845850|gb|EEE83397.1| hypothetical protein POPTR_0001s36260g [Populus trichocarpa] Length = 547 Score = 57.4 bits (137), Expect(2) = 8e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AESELKRLRQSLCFKARPLPDFYRKREASKNQ 98 AE+ELKRLRQSLCFKARPLPDFY++R A NQ Sbjct: 443 AETELKRLRQSLCFKARPLPDFYKQRVAPNNQ 474 Score = 21.2 bits (43), Expect(2) = 8e-07 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +2 Query: 191 IPITHSQFPKLEKEHISNMVQSTS 262 +P+THS+ P+ ++ + ++S S Sbjct: 478 VPLTHSESPEPGRKMTPSKIRSAS 501