BLASTX nr result
ID: Paeonia25_contig00048512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00048512 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_009187176.1| hypothetical protein [Cecembia lonarensis] g... 56 4e-06 ref|WP_008409321.1| hypothetical protein [Bacillus isronensis] g... 56 4e-06 >ref|WP_009187176.1| hypothetical protein [Cecembia lonarensis] gi|405551390|gb|EKB47241.1| hypothetical protein B879_04163 [Cecembia lonarensis LW9] Length = 133 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/64 (42%), Positives = 39/64 (60%) Frame = +1 Query: 1 QRIPLNVPVKKSDLVCIEGYSRGKGRHKLNCVKLLRKDVETCGLTEELALDRAEWKKRIH 180 QR P + PV++ D RG+GR + + LRKD+E LTE++ DRA+W+ RIH Sbjct: 68 QRRPTDAPVRRCDYGTEVRGRRGRGRPRKTLEETLRKDLEYLDLTEDMTQDRAQWRSRIH 127 Query: 181 IGNP 192 I +P Sbjct: 128 IADP 131 >ref|WP_008409321.1| hypothetical protein [Bacillus isronensis] gi|405383715|gb|EKB43273.1| hypothetical protein B857_03969 [Bacillus isronensis B3W22] Length = 109 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/64 (39%), Positives = 40/64 (62%) Frame = +1 Query: 1 QRIPLNVPVKKSDLVCIEGYSRGKGRHKLNCVKLLRKDVETCGLTEELALDRAEWKKRIH 180 QR+P + P+++ D RG+GR + + LRKD+E LTE++ DRA+W+ +IH Sbjct: 44 QRMPTDAPIRRCDYGTEVQGRRGRGRPRKTLEETLRKDLEYLDLTEDMTQDRAQWRSKIH 103 Query: 181 IGNP 192 I +P Sbjct: 104 IADP 107