BLASTX nr result
ID: Paeonia25_contig00048391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00048391 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007369468.1| hypothetical protein DICSQDRAFT_91716 [Dicho... 55 8e-06 >ref|XP_007369468.1| hypothetical protein DICSQDRAFT_91716 [Dichomitus squalens LYAD-421 SS1] gi|395325417|gb|EJF57840.1| hypothetical protein DICSQDRAFT_91716 [Dichomitus squalens LYAD-421 SS1] Length = 926 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 5/72 (6%) Frame = +2 Query: 23 MPFETYLRA-----QLSXXXXXXXANFSQHVNFQIPHLAYSAPTVAPGGGAQVLPSGLCP 187 MPF YL++ Q + +FS V+FQ+P+L ++APTV PGGGA+ LP+GL P Sbjct: 1 MPFSRYLQSSERDGQNNDQDDDIDHHFSSAVHFQLPNLIFNAPTVPPGGGAEALPAGLYP 60 Query: 188 QFATNPFSSSPW 223 P SS W Sbjct: 61 -----PSSSLSW 67