BLASTX nr result
ID: Paeonia25_contig00048140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00048140 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65082.1| hypothetical protein M569_09700 [Genlisea aurea] 66 6e-09 ref|XP_006363411.1| PREDICTED: uncharacterized protein LOC102602... 64 3e-08 gb|EYU44136.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus... 62 6e-08 ref|XP_002530009.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 ref|XP_004233372.1| PREDICTED: uncharacterized protein LOC101245... 60 2e-07 ref|XP_002278703.2| PREDICTED: uncharacterized protein LOC100249... 60 2e-07 ref|XP_006373339.1| hypothetical protein POPTR_0017s12320g [Popu... 57 3e-06 ref|XP_007032613.1| Uncharacterized protein TCM_018653 [Theobrom... 57 3e-06 gb|EYU44137.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus... 56 5e-06 >gb|EPS65082.1| hypothetical protein M569_09700 [Genlisea aurea] Length = 249 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 141 ASFD*YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 ASFD YLEDKPRVF+AIFPDKRRSQQLNEEEW Sbjct: 62 ASFDLYLEDKPRVFEAIFPDKRRSQQLNEEEW 93 >ref|XP_006363411.1| PREDICTED: uncharacterized protein LOC102602574 [Solanum tuberosum] Length = 249 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 141 ASFD*YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 ASFD YLE+KPRVF+AIFPDKRRSQQLNEEEW Sbjct: 71 ASFDGYLENKPRVFKAIFPDKRRSQQLNEEEW 102 >gb|EYU44136.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus guttatus] Length = 254 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 141 ASFD*YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 ASFD YLEDKPRVF+AIFPDKRRS QLNE+EW Sbjct: 77 ASFDQYLEDKPRVFKAIFPDKRRSNQLNEDEW 108 >ref|XP_002530009.1| conserved hypothetical protein [Ricinus communis] gi|223530488|gb|EEF32371.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 141 ASFD*YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 ASFD YLEDKPRVF+A+FPDKRRS+QLN+EEW Sbjct: 81 ASFDRYLEDKPRVFKAMFPDKRRSEQLNKEEW 112 >ref|XP_004233372.1| PREDICTED: uncharacterized protein LOC101245722 [Solanum lycopersicum] Length = 241 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 129 KNQTASFD*YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 +N A FD YLE+KPRVF+AIFPDKRRS QLN+EEW Sbjct: 59 ENPRACFDRYLENKPRVFKAIFPDKRRSHQLNQEEW 94 >ref|XP_002278703.2| PREDICTED: uncharacterized protein LOC100249192 [Vitis vinifera] gi|296082953|emb|CBI22254.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 60.5 bits (145), Expect = 2e-07 Identities = 41/88 (46%), Positives = 47/88 (53%), Gaps = 22/88 (25%) Frame = +3 Query: 39 LSKGLWKRQL-KHIQPW*TNAVN*TKRQISIKNQT---------------------ASFD 152 L G WK QL K + W + V K Q IKNQ A FD Sbjct: 20 LGIGKWKDQLVKPNRQW--HVVTQPKWQPVIKNQMVKPSTYTSRISTDLPLYESPGALFD 77 Query: 153 *YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 YLED+PRVF+AIFPDKRRSQ++NEEEW Sbjct: 78 EYLEDQPRVFKAIFPDKRRSQRINEEEW 105 >ref|XP_006373339.1| hypothetical protein POPTR_0017s12320g [Populus trichocarpa] gi|550320118|gb|ERP51136.1| hypothetical protein POPTR_0017s12320g [Populus trichocarpa] Length = 125 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 141 ASFD*YLEDKPRVFQAIFPDKRRSQQLNE 227 ASFD YLEDKPRVF AIFPDKRRSQQLNE Sbjct: 77 ASFDGYLEDKPRVFNAIFPDKRRSQQLNE 105 >ref|XP_007032613.1| Uncharacterized protein TCM_018653 [Theobroma cacao] gi|508711642|gb|EOY03539.1| Uncharacterized protein TCM_018653 [Theobroma cacao] Length = 281 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 141 ASFD*YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 A FD YLEDKPR+F A+FPDK RSQQLN++EW Sbjct: 104 ALFDQYLEDKPRIFNAMFPDKHRSQQLNQDEW 135 >gb|EYU44137.1| hypothetical protein MIMGU_mgv1a012305mg [Mimulus guttatus] Length = 249 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 156 YLEDKPRVFQAIFPDKRRSQQLNEEEW 236 YLEDKPRVF+AIFPDKRRS QLNE+EW Sbjct: 77 YLEDKPRVFKAIFPDKRRSNQLNEDEW 103