BLASTX nr result
ID: Paeonia25_contig00048077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00048077 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263673.2| PREDICTED: putative pentatricopeptide repeat... 52 5e-09 >ref|XP_002263673.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Vitis vinifera] Length = 1088 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = -1 Query: 375 G*KKKSFNFI*EMQEGDVENDAPTMVTLVNFCANLATLEHGKQ 247 G KK+SFN EM E D+E D TMVT+VN C++L LEHG Q Sbjct: 691 GLKKESFNHFLEMLESDIEYDVLTMVTIVNLCSSLPALEHGDQ 733 Score = 33.5 bits (75), Expect(2) = 5e-09 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = -3 Query: 487 STFVSCVRIDKSIHLFKWMTKINIASWNSIHMG*ANGGVKEK 362 S FV+ R + + +LF M + N A WNSI G AN G+K++ Sbjct: 654 SAFVNSGRANDAKNLFDQMEQRNTALWNSILAGYANKGLKKE 695