BLASTX nr result
ID: Paeonia25_contig00047813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047813 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516830.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_002315542.1| hypothetical protein POPTR_0010s02840g [Popu... 63 4e-08 ref|XP_002312376.1| hypothetical protein POPTR_0008s11410g [Popu... 63 4e-08 gb|EXC05711.1| hypothetical protein L484_011291 [Morus notabilis] 62 8e-08 ref|XP_002277209.2| PREDICTED: uncharacterized protein LOC100264... 60 3e-07 gb|EPS61228.1| hypothetical protein M569_13571, partial [Genlise... 60 4e-07 ref|XP_004296768.1| PREDICTED: uncharacterized protein LOC101311... 58 1e-06 >ref|XP_002516830.1| conserved hypothetical protein [Ricinus communis] gi|223543918|gb|EEF45444.1| conserved hypothetical protein [Ricinus communis] Length = 193 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTTSKT 114 LPPVIGAISGTVFM+FPNKRHG+GYPSSD+ S + Sbjct: 156 LPPVIGAISGTVFMVFPNKRHGVGYPSSDSPSSS 189 >ref|XP_002315542.1| hypothetical protein POPTR_0010s02840g [Populus trichocarpa] gi|222864582|gb|EEF01713.1| hypothetical protein POPTR_0010s02840g [Populus trichocarpa] Length = 186 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTT 123 LPP IGA+SGTVFMLFPNKRHGIGYPSSD++ Sbjct: 153 LPPAIGAVSGTVFMLFPNKRHGIGYPSSDSS 183 >ref|XP_002312376.1| hypothetical protein POPTR_0008s11410g [Populus trichocarpa] gi|222852196|gb|EEE89743.1| hypothetical protein POPTR_0008s11410g [Populus trichocarpa] Length = 188 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTT 123 LPP IGA+SGTVFMLFPNKRHGIGYPSSD++ Sbjct: 154 LPPAIGAVSGTVFMLFPNKRHGIGYPSSDSS 184 >gb|EXC05711.1| hypothetical protein L484_011291 [Morus notabilis] Length = 196 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTTSKT 114 LPPVIGAISG+VFMLFPN RHGIGYPSSD + T Sbjct: 162 LPPVIGAISGSVFMLFPNNRHGIGYPSSDDDNTT 195 >ref|XP_002277209.2| PREDICTED: uncharacterized protein LOC100264790 [Vitis vinifera] gi|297736946|emb|CBI26147.3| unnamed protein product [Vitis vinifera] Length = 166 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTTSKT 114 LPPVIGAIS TVFM+FPNKRHGIGYP+S T+ ++ Sbjct: 133 LPPVIGAISSTVFMVFPNKRHGIGYPASQTSHES 166 >gb|EPS61228.1| hypothetical protein M569_13571, partial [Genlisea aurea] Length = 181 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTTSKT 114 LPPVIGAISGTVF++FPN+RHGIGYPS D SKT Sbjct: 148 LPPVIGAISGTVFVIFPNRRHGIGYPSDD-KSKT 180 >ref|XP_004296768.1| PREDICTED: uncharacterized protein LOC101311466 [Fragaria vesca subsp. vesca] Length = 201 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 215 LPPVIGAISGTVFMLFPNKRHGIGYPSSDTTS 120 LPPVIG I+GTVF++FPNKRHGIGYPSS + S Sbjct: 163 LPPVIGTIAGTVFVVFPNKRHGIGYPSSSSDS 194