BLASTX nr result
ID: Paeonia25_contig00047722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047722 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007134308.1| hypothetical protein PHAVU_010G036200g [Phas... 64 2e-08 >ref|XP_007134308.1| hypothetical protein PHAVU_010G036200g [Phaseolus vulgaris] gi|561007353|gb|ESW06302.1| hypothetical protein PHAVU_010G036200g [Phaseolus vulgaris] Length = 564 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 1/82 (1%) Frame = -1 Query: 309 RQRDDVVANICRAFYANFIPFNVMKDPFF*ASIG-VGEYGEWLMLPLYHKVRFSFLKKEV 133 + R+ V+ +IC+ Y N +PFN+++ F + V EYG L P YH+VR +LKK V Sbjct: 105 KDRELVIIDICKCIYGNALPFNLVRSSLFVQMLKFVAEYGNGLKPPTYHEVRVPYLKKSV 164 Query: 132 EVINSGLVGNYLEWKKAGQALR 67 + I L +EWKK G ++ Sbjct: 165 DKIQVSLEKYRVEWKKCGNVVK 186