BLASTX nr result
ID: Paeonia25_contig00047610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047610 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17575.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_002269078.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_007204324.1| hypothetical protein PRUPE_ppa004294mg [Prun... 70 2e-10 ref|XP_006466716.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006425741.1| hypothetical protein CICLE_v10027297mg [Citr... 66 6e-09 ref|XP_002525094.1| pentatricopeptide repeat-containing protein,... 64 2e-08 ref|XP_002525091.1| hypothetical protein RCOM_0552890 [Ricinus c... 63 5e-08 ref|XP_006383251.1| hypothetical protein POPTR_0005s12880g [Popu... 62 1e-07 ref|XP_007047032.1| Tetratricopeptide repeat-like superfamily pr... 60 4e-07 gb|EYU44305.1| hypothetical protein MIMGU_mgv1a003952mg [Mimulus... 59 7e-07 ref|XP_004505281.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_004503279.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_007160534.1| hypothetical protein PHAVU_002G329700g [Phas... 57 2e-06 ref|XP_003631109.1| Pentatricopeptide repeat-containing protein ... 56 6e-06 >emb|CBI17575.3| unnamed protein product [Vitis vinifera] Length = 656 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 A GTYN+LLAGL+K GR RE E +RKEKK+ S DIVSM++ ICNLLF+G++V Sbjct: 599 ALGTYNLLLAGLEKKGRAREAEIYRKEKKTLHTHGHSQDIVSMDEKICNLLFSGNLV 655 >ref|XP_002269078.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Vitis vinifera] Length = 519 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 A GTYN+LLAGL+K GR RE E +RKEKK+ S DIVSM++ ICNLLF+G++V Sbjct: 462 ALGTYNLLLAGLEKKGRAREAEIYRKEKKTLHTHGHSQDIVSMDEKICNLLFSGNLV 518 >ref|XP_007204324.1| hypothetical protein PRUPE_ppa004294mg [Prunus persica] gi|462399855|gb|EMJ05523.1| hypothetical protein PRUPE_ppa004294mg [Prunus persica] Length = 518 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +2 Query: 8 GTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 GTYNVLLAGLQK GR+RE E +RKEKKS Q S + V ++ IC+ LFAGDVV Sbjct: 463 GTYNVLLAGLQKLGRVREAEMYRKEKKSLQSDGPSQNAVPIDQKICDFLFAGDVV 517 >ref|XP_006466716.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Citrus sinensis] Length = 582 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 + GT+NVLLAGL+K GR+ + E +RKEKKS Q S D V ME+ IC+LL+ GD V Sbjct: 525 SLGTFNVLLAGLEKLGRVSDAEIYRKEKKSIQADALSKDTVPMEEKICDLLYGGDGV 581 >ref|XP_006425741.1| hypothetical protein CICLE_v10027297mg [Citrus clementina] gi|557527731|gb|ESR38981.1| hypothetical protein CICLE_v10027297mg [Citrus clementina] Length = 522 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 + GT+NVLLAGL+K GR+ + E +RKEKKS Q S D V ME+ IC+LL+ GD V Sbjct: 465 SLGTFNVLLAGLEKLGRVSDAEIYRKEKKSIQADALSKDTVPMEEKICDLLYGGDGV 521 >ref|XP_002525094.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535553|gb|EEF37221.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 472 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 + GTYNVLLAGL+KSGR+ E ++FRKEK+S + ME+ IC+LLFAG +V Sbjct: 415 SLGTYNVLLAGLEKSGRVCETDNFRKEKRSLMADGNRLSCLPMEEKICDLLFAGSLV 471 >ref|XP_002525091.1| hypothetical protein RCOM_0552890 [Ricinus communis] gi|223535550|gb|EEF37218.1| hypothetical protein RCOM_0552890 [Ricinus communis] Length = 129 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVVF 175 + GTYNVLLAGL+KSGR+ E ++FRKEK+S + ME+ IC+LLFAG + + Sbjct: 29 SLGTYNVLLAGLEKSGRVCETDNFRKEKRSLMADGNRLSCLPMEEKICDLLFAGSLPY 86 >ref|XP_006383251.1| hypothetical protein POPTR_0005s12880g [Populus trichocarpa] gi|550338833|gb|ERP61048.1| hypothetical protein POPTR_0005s12880g [Populus trichocarpa] Length = 517 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 + GTYNVLLAGL+ SGRI E +++RKEKK I + V M ICNLLFA +V Sbjct: 460 SLGTYNVLLAGLESSGRISEAKTYRKEKKGLLINNHHQNSVPMGQKICNLLFASHLV 516 >ref|XP_007047032.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508699293|gb|EOX91189.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 577 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = +2 Query: 2 AFGTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 + GTY VLLAGL+K GR+ E++RKEKKS Q + + +E+ IC+LLFA DVV Sbjct: 520 SLGTYCVLLAGLEKLGRVSTAETYRKEKKSLQKDAYFRESIPIEEKICDLLFARDVV 576 >gb|EYU44305.1| hypothetical protein MIMGU_mgv1a003952mg [Mimulus guttatus] Length = 552 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +2 Query: 8 GTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFA 160 GTY VLLAGL+K G+ REM+ +RKEKK + G + VSME+ ICNLLFA Sbjct: 503 GTYCVLLAGLEKCGKAREMDYYRKEKKRLENGRSFN--VSMEETICNLLFA 551 >ref|XP_004505281.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Cicer arietinum] Length = 166 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = +2 Query: 8 GTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 GTYN+L+AGL+++GR E E RK KK+ + + + VS E +C+LLFAGDV+ Sbjct: 111 GTYNILVAGLERNGRYSEAELHRKSKKNLHSNIGTRESVSTEGKMCDLLFAGDVI 165 >ref|XP_004503279.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Cicer arietinum] Length = 580 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = +2 Query: 8 GTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 GTYN+L+AGL+++GR E E RK KK+ + + + VS E +C+LLFAGDV+ Sbjct: 525 GTYNILVAGLERNGRYSEAELHRKSKKNLHSNIGTRESVSTEGKMCDLLFAGDVI 579 >ref|XP_007160534.1| hypothetical protein PHAVU_002G329700g [Phaseolus vulgaris] gi|561033949|gb|ESW32528.1| hypothetical protein PHAVU_002G329700g [Phaseolus vulgaris] Length = 600 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +2 Query: 8 GTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 GTYNVL+AGL+++GR E + +RK KK+ S + V +E ICNL+F+ DV+ Sbjct: 545 GTYNVLIAGLERNGRYAEADHYRKAKKTLHANSGSQESVLIEGKICNLIFSVDVI 599 >ref|XP_003631109.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355525131|gb|AET05585.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 687 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +2 Query: 8 GTYNVLLAGLQKSGRIREMESFRKEKKSRQIGMQSDDIVSMEDNICNLLFAGDVV 172 GT+N+L+AGL+++GR E RK KK+ + S + +S E IC+LLFAGDV+ Sbjct: 632 GTFNILVAGLERNGRFSEAGVHRKAKKNLNSNIGSQENLSTEGRICDLLFAGDVI 686