BLASTX nr result
ID: Paeonia25_contig00047348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047348 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007396452.1| hypothetical protein PHACADRAFT_209644 [Phan... 55 8e-06 >ref|XP_007396452.1| hypothetical protein PHACADRAFT_209644 [Phanerochaete carnosa HHB-10118-sp] gi|409046677|gb|EKM56157.1| hypothetical protein PHACADRAFT_209644 [Phanerochaete carnosa HHB-10118-sp] Length = 609 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/73 (41%), Positives = 38/73 (52%) Frame = -3 Query: 219 LGTLGRGGHGDVLLGRLDCGDLVAVKVAHKPMVFRCPGTRNLLRVEQEALRIAALRRMHF 40 LG LG GG G V+ R G VA+KV HK +R P R L+ E+ R F Sbjct: 241 LGMLGEGGSGRVMCARARTGHTVAIKVVHKARAYRDPFGRENLKDEKFTWERVTHERRPF 300 Query: 39 VAPLVLSWEDEEN 1 + L+LSW+D EN Sbjct: 301 LVSLLLSWDDPEN 313