BLASTX nr result
ID: Paeonia25_contig00045204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045204 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513196.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002513196.1| conserved hypothetical protein [Ricinus communis] gi|223547694|gb|EEF49187.1| conserved hypothetical protein [Ricinus communis] Length = 64 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -1 Query: 211 MNLFSAIFSCFMPRSSSQVSDDT-SDGVAVQKQPYSKKPDIKSQSQEAPIVVSYFP 47 M LFSAI SCF+P SSS+VSDD + + K ++KP KS+S API+VSYFP Sbjct: 1 MVLFSAILSCFVPSSSSRVSDDAEACSGSSMKVSNNEKPRSKSRSSSAPIIVSYFP 56