BLASTX nr result
ID: Paeonia25_contig00044370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044370 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002474889.1| predicted protein [Postia placenta Mad-698-R... 58 1e-06 >ref|XP_002474889.1| predicted protein [Postia placenta Mad-698-R] gi|220725952|gb|EED79918.1| predicted protein [Postia placenta Mad-698-R] Length = 537 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/69 (46%), Positives = 40/69 (57%) Frame = +3 Query: 144 ASLAEKSLFPHLETVRLVDTLLPHRDPVPAQQVPYTLSAARNGQQTLAWWTEKFDEFGVD 323 A LA ++LFP LETVR V L V A PY + WWTEK++E G+D Sbjct: 441 AFLAHRALFPALETVRTVGLL------VDASTDPYA-------RDIFIWWTEKYEERGLD 487 Query: 324 LQDGQGLVW 350 LQDG+G+VW Sbjct: 488 LQDGEGVVW 496