BLASTX nr result
ID: Paeonia25_contig00044237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044237 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ60348.1| hypothetical protein GLOTRDRAFT_67890 [Gloeophyll... 90 3e-16 emb|CCM04192.1| predicted protein [Fibroporia radiculosa] 86 5e-15 ref|XP_007312904.1| hypothetical protein SERLADRAFT_455547 [Serp... 83 4e-14 ref|XP_001874012.1| predicted protein [Laccaria bicolor S238N-H8... 83 4e-14 ref|XP_007297957.1| hypothetical protein STEHIDRAFT_46064 [Stere... 81 1e-13 gb|EGN93126.1| hypothetical protein SERLA73DRAFT_189981 [Serpula... 79 5e-13 ref|XP_007378860.1| hypothetical protein PUNSTDRAFT_95379 [Punct... 79 7e-13 gb|EPT04037.1| hypothetical protein FOMPIDRAFT_1028362 [Fomitops... 78 1e-12 gb|EIW64352.1| hypothetical protein TRAVEDRAFT_110159 [Trametes ... 78 1e-12 ref|XP_003037393.1| hypothetical protein SCHCODRAFT_104160 [Schi... 76 4e-12 ref|XP_001829172.2| hypothetical protein CC1G_01852 [Coprinopsis... 76 6e-12 ref|XP_002395309.1| hypothetical protein MPER_04655 [Moniliophth... 70 2e-10 ref|XP_007360399.1| hypothetical protein DICSQDRAFT_76133 [Dicho... 68 2e-09 gb|ESK94014.1| ribonucleases p mrp protein subunit pop3 kda subu... 66 6e-09 gb|EIW87016.1| hypothetical protein CONPUDRAFT_79198, partial [C... 66 6e-09 gb|ELU42097.1| Kri1 domain-containing protein [Rhizoctonia solan... 64 2e-08 ref|XP_007402736.1| hypothetical protein PHACADRAFT_61593, parti... 64 2e-08 ref|XP_007402771.1| hypothetical protein PHACADRAFT_50443, parti... 64 2e-08 gb|ETW86993.1| hypothetical protein HETIRDRAFT_308446 [Heterobas... 59 9e-07 emb|CCO29274.1| hypothetical protein BN14_03282 [Rhizoctonia sol... 58 1e-06 >gb|EPQ60348.1| hypothetical protein GLOTRDRAFT_67890 [Gloeophyllum trabeum ATCC 11539] Length = 347 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/71 (57%), Positives = 56/71 (78%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MSEKT +TH VSNRA+ + E+KVVYKSVLD+P RI WP++P+N+ N+LLSRVIA+ + Sbjct: 1 MSEKTAKTHTAVSNRARAKQALERKVVYKSVLDNPHRIQWPSIPMNIGNSLLSRVIALLD 60 Query: 36 SVCQYHISRNR 4 V YH+ R++ Sbjct: 61 GVASYHLLRDQ 71 >emb|CCM04192.1| predicted protein [Fibroporia radiculosa] Length = 463 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/71 (50%), Positives = 56/71 (78%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 M+++ VRTH + SNRA + E+KV+++SVLD+PFR+ WP+VP+NVQN++L+RV MA Sbjct: 1 MADRAVRTHTNPSNRANARDQAERKVIFRSVLDNPFRVPWPSVPINVQNSILARVADMAV 60 Query: 36 SVCQYHISRNR 4 V +YH++R + Sbjct: 61 GVSEYHLAREK 71 >ref|XP_007312904.1| hypothetical protein SERLADRAFT_455547 [Serpula lacrymans var. lacrymans S7.9] gi|336389877|gb|EGO31020.1| hypothetical protein SERLADRAFT_455547 [Serpula lacrymans var. lacrymans S7.9] Length = 349 Score = 83.2 bits (204), Expect = 4e-14 Identities = 36/70 (51%), Positives = 53/70 (75%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MS+KT RTH HVSNRAK + E+K V+KSVLD+PF + WP++P+N+QN L+R++++ + Sbjct: 1 MSDKTARTHTHVSNRAKNRATVERKPVFKSVLDNPFHVRWPSIPVNLQNLCLARLVSILD 60 Query: 36 SVCQYHISRN 7 V + SRN Sbjct: 61 GVSESRRSRN 70 >ref|XP_001874012.1| predicted protein [Laccaria bicolor S238N-H82] gi|164651564|gb|EDR15804.1| predicted protein [Laccaria bicolor S238N-H82] Length = 323 Score = 83.2 bits (204), Expect = 4e-14 Identities = 34/69 (49%), Positives = 52/69 (75%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MS+K RTH H+SNRAK ++KV +KSVLD+P+RI WP+VP+N+QN +L+ ++++ E Sbjct: 1 MSDKAARTHSHISNRAKASGKVDRKVAFKSVLDNPYRIEWPSVPINLQNAVLAHIVSLLE 60 Query: 36 SVCQYHISR 10 V +Y +R Sbjct: 61 GVAEYQRNR 69 >ref|XP_007297957.1| hypothetical protein STEHIDRAFT_46064 [Stereum hirsutum FP-91666 SS1] gi|389751107|gb|EIM92180.1| hypothetical protein STEHIDRAFT_46064 [Stereum hirsutum FP-91666 SS1] Length = 331 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/69 (53%), Positives = 53/69 (76%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 M+ KT + H +VS+RA+ + E+KVV+KSVL +PF I WP+VP NVQNT L+R++AM E Sbjct: 1 MAAKTAKLHTNVSHRARDREALERKVVFKSVLHNPFHIAWPSVPANVQNTALARLLAMIE 60 Query: 36 SVCQYHISR 10 V +YH++R Sbjct: 61 GVSEYHLAR 69 >gb|EGN93126.1| hypothetical protein SERLA73DRAFT_189981 [Serpula lacrymans var. lacrymans S7.3] Length = 338 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/64 (51%), Positives = 50/64 (78%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MS+KT RTH HVSNRAK + E+K V+KSVLD+PF + WP++P+N+QN L+R++++ + Sbjct: 1 MSDKTARTHTHVSNRAKNRATVERKPVFKSVLDNPFHVRWPSIPVNLQNLCLARLVSILD 60 Query: 36 SVCQ 25 V + Sbjct: 61 GVSE 64 >ref|XP_007378860.1| hypothetical protein PUNSTDRAFT_95379 [Punctularia strigosozonata HHB-11173 SS5] gi|390604552|gb|EIN13943.1| hypothetical protein PUNSTDRAFT_95379 [Punctularia strigosozonata HHB-11173 SS5] Length = 348 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/69 (50%), Positives = 50/69 (72%) Frame = -3 Query: 210 EKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAESV 31 +K R H + SNRA + +++VVYK VLD+PF + WP++ NVQNTLL+R+IA+AE+V Sbjct: 2 DKAARVHSNASNRAGTRAVSDRRVVYKGVLDNPFTVKWPSLAPNVQNTLLARLIALAEAV 61 Query: 30 CQYHISRNR 4 YH+ R R Sbjct: 62 GNYHLERER 70 >gb|EPT04037.1| hypothetical protein FOMPIDRAFT_1028362 [Fomitopsis pinicola FP-58527 SS1] Length = 331 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/71 (50%), Positives = 50/71 (70%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 M++K VRTH + SNR+K + E+K V++SVLD+PFRI WP+VP NVQNT+L+R I M Sbjct: 1 MADKLVRTHTNQSNRSKAKEALERKTVFRSVLDNPFRIQWPSVPANVQNTILARFIDMLH 60 Query: 36 SVCQYHISRNR 4 V +Y + Sbjct: 61 GVPEYRTEHEK 71 >gb|EIW64352.1| hypothetical protein TRAVEDRAFT_110159 [Trametes versicolor FP-101664 SS1] Length = 332 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/71 (45%), Positives = 54/71 (76%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MS++T R H +SNRAK + + E+K V++SV+++PFR+ WP+VPLN QN +L+ ++ M Sbjct: 1 MSDQTARAHTSMSNRAKARDNGERKTVFRSVVENPFRVQWPSVPLNAQNAILACLVDMLS 60 Query: 36 SVCQYHISRNR 4 +V ++++SR R Sbjct: 61 AVAEHNLSRER 71 >ref|XP_003037393.1| hypothetical protein SCHCODRAFT_104160 [Schizophyllum commune H4-8] gi|300111090|gb|EFJ02491.1| hypothetical protein SCHCODRAFT_104160, partial [Schizophyllum commune H4-8] Length = 379 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/70 (52%), Positives = 49/70 (70%), Gaps = 5/70 (7%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQ-----IDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRV 52 M++KTV+TH +SNR KPQ EKKVV+KSVLD+P+RI WP VP NVQN + S Sbjct: 1 MADKTVKTHTTISNREKPQGKKQQAAQEKKVVFKSVLDNPYRIQWPKVPENVQNLVFSHA 60 Query: 51 IAMAESVCQY 22 ++M E + +Y Sbjct: 61 LSMLEGMGEY 70 >ref|XP_001829172.2| hypothetical protein CC1G_01852 [Coprinopsis cinerea okayama7#130] gi|298411574|gb|EAU92807.2| hypothetical protein CC1G_01852 [Coprinopsis cinerea okayama7#130] Length = 302 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/66 (50%), Positives = 48/66 (72%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MS KTV+T+ SNR +P+ EKKVV+K VLD+PFR+ WP+VPLN+QN +L+ ++ + + Sbjct: 1 MSSKTVKTYTQQSNRERPRNASEKKVVFKPVLDNPFRVRWPSVPLNLQNAVLAYLLTLLD 60 Query: 36 SVCQYH 19 V H Sbjct: 61 GVASCH 66 >ref|XP_002395309.1| hypothetical protein MPER_04655 [Moniliophthora perniciosa FA553] gi|215465824|gb|EEB96239.1| hypothetical protein MPER_04655 [Moniliophthora perniciosa FA553] Length = 217 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 1/67 (1%) Frame = -3 Query: 204 TVRTHRHVSNRAKPQ-IDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAESVC 28 + +TH H SNRA+P+ + KK V+K V ++PFRI+WP VP+N+QN +L++ +++ E V Sbjct: 4 SAKTHSHQSNRARPKPSENNKKQVFKPVFENPFRIHWPNVPVNLQNLVLAQTLSLLEGVA 63 Query: 27 QYHISRN 7 +YH R+ Sbjct: 64 EYHRMRD 70 >ref|XP_007360399.1| hypothetical protein DICSQDRAFT_76133 [Dichomitus squalens LYAD-421 SS1] gi|395334553|gb|EJF66929.1| hypothetical protein DICSQDRAFT_76133 [Dichomitus squalens LYAD-421 SS1] Length = 327 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/71 (38%), Positives = 49/71 (69%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 MS++ R H SNRAKP+ +++V ++SV+D+PF + WP+VP NVQN +L+ ++ M Sbjct: 1 MSQQIARAHTSQSNRAKPREGSDRRVQFRSVVDNPFHVQWPSVPANVQNAILACMLDMLS 60 Query: 36 SVCQYHISRNR 4 + ++++R + Sbjct: 61 GLADHNLAREQ 71 >gb|ESK94014.1| ribonucleases p mrp protein subunit pop3 kda subunit [Moniliophthora roreri MCA 2997] Length = 304 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/67 (41%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -3 Query: 204 TVRTHRHVSNRAKPQ-IDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAESVC 28 + + H H SNRA+P+ + KK V+K V D+PFRI+WP VP+N+QN +L++ +++ + V Sbjct: 4 SAKVHSHQSNRARPKPSENSKKQVFKPVFDNPFRIHWPNVPVNLQNLVLAQTLSLLDGVA 63 Query: 27 QYHISRN 7 +Y R+ Sbjct: 64 EYQRMRD 70 >gb|EIW87016.1| hypothetical protein CONPUDRAFT_79198, partial [Coniophora puteana RWD-64-598 SS2] Length = 166 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/61 (50%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = -3 Query: 216 MSEKTVRTH-RHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMA 40 M+ + R H HVSNRAK + EKK V KSVLD+P ++ WP++PLN+QN +LSR++ + Sbjct: 1 MATQNARVHGTHVSNRAKAKEVLEKKAVLKSVLDNPLKVKWPSIPLNLQNLILSRLVDVL 60 Query: 39 E 37 E Sbjct: 61 E 61 >gb|ELU42097.1| Kri1 domain-containing protein [Rhizoctonia solani AG-1 IA] Length = 1131 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 7/70 (10%) Frame = -3 Query: 198 RTHRHVSNRA-------KPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMA 40 R H SNRA K + + +++VVYKSVL++P++I WP PLNVQN+LL+ + + Sbjct: 33 RIHTQPSNRANASLGKGKSKAEDDRRVVYKSVLENPYQIKWPQTPLNVQNSLLACLADLL 92 Query: 39 ESVCQYHISR 10 V YHI+R Sbjct: 93 PEVASYHIAR 102 >ref|XP_007402736.1| hypothetical protein PHACADRAFT_61593, partial [Phanerochaete carnosa HHB-10118-sp] gi|409038906|gb|EKM48712.1| hypothetical protein PHACADRAFT_61593, partial [Phanerochaete carnosa HHB-10118-sp] Length = 302 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/66 (37%), Positives = 46/66 (69%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 M++ + H + SNRA+ + E+K+VYKSVLD+P ++ WP +P N+QN +L+ ++++ + Sbjct: 1 MTDGHAKKHTNKSNRARDNV--ERKIVYKSVLDNPLQVRWPNIPENIQNAILALIVSILD 58 Query: 36 SVCQYH 19 V + H Sbjct: 59 GVAEMH 64 >ref|XP_007402771.1| hypothetical protein PHACADRAFT_50443, partial [Phanerochaete carnosa HHB-10118-sp] gi|409038844|gb|EKM48677.1| hypothetical protein PHACADRAFT_50443, partial [Phanerochaete carnosa HHB-10118-sp] Length = 302 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/66 (39%), Positives = 46/66 (69%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVIAMAE 37 M++ + H + SNRA+ + E+KVVYKSVLD+P ++ WP +P N+QN +L+ ++++ + Sbjct: 1 MTDGHAKKHTNKSNRARDNV--ERKVVYKSVLDNPLQVRWPNIPENIQNAVLALIVSILD 58 Query: 36 SVCQYH 19 V + H Sbjct: 59 GVAEVH 64 >gb|ETW86993.1| hypothetical protein HETIRDRAFT_308446 [Heterobasidion irregulare TC 32-1] Length = 315 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/66 (39%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = -3 Query: 216 MSEKTVRTHRHVSNRAKPQIDPEKKVVYKSVLDSPFRINW-PTVPLNVQNTLLSRVIAMA 40 MS +TH +S RAK + E+K+V+KSVL +PF W P+VP+ +Q+++L+ ++A+ Sbjct: 1 MSNNPAKTHNAISLRAKARAPLERKIVHKSVLGNPFHTQWSPSVPVEMQSSILAHLVALV 60 Query: 39 ESVCQY 22 + V +Y Sbjct: 61 DGVGEY 66 >emb|CCO29274.1| hypothetical protein BN14_03282 [Rhizoctonia solani AG-1 IB] Length = 309 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 7/73 (9%) Frame = -3 Query: 207 KTVRTHRHVSNRA-------KPQIDPEKKVVYKSVLDSPFRINWPTVPLNVQNTLLSRVI 49 + R H SNRA K + +++VVYK VL++P++I WP PLN+QN LL+ + Sbjct: 8 REARVHAQTSNRANASLAKGKSKAADDRRVVYKPVLENPYQIKWPPTPLNIQNGLLACLA 67 Query: 48 AMAESVCQYHISR 10 + V +YH R Sbjct: 68 DLLPEVAKYHFVR 80