BLASTX nr result
ID: Paeonia25_contig00044113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044113 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421302.1| hypothetical protein CICLE_v10005479mg [Citr... 56 5e-06 >ref|XP_006421302.1| hypothetical protein CICLE_v10005479mg [Citrus clementina] gi|557523175|gb|ESR34542.1| hypothetical protein CICLE_v10005479mg [Citrus clementina] Length = 172 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +2 Query: 2 QDEKNHRGRSRDAILGACLYIACRLEGKPRTVKG 103 +D+K+ RGR++DA+L ACLYIACR E KPRTVKG Sbjct: 137 EDQKSSRGRNQDALLAACLYIACRQEDKPRTVKG 170