BLASTX nr result
ID: Paeonia25_contig00044013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044013 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB42941.1| hypothetical protein L484_013964 [Morus notabilis] 56 6e-06 >gb|EXB42941.1| hypothetical protein L484_013964 [Morus notabilis] Length = 375 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 242 NELYVVYMDRVTGELVKQMGQVSCLEKLDPGILDKLL 132 N LYV+YMDRVTGEL KQ+GQV L+K+ P ILDKLL Sbjct: 338 NGLYVLYMDRVTGELGKQVGQVPSLQKMKPDILDKLL 374