BLASTX nr result
ID: Paeonia25_contig00043074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043074 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM01476.1| predicted protein [Fibroporia radiculosa] 56 4e-06 >emb|CCM01476.1| predicted protein [Fibroporia radiculosa] Length = 497 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = -1 Query: 251 LINITSTTLIDLPLFCTVFARHVLSVSPDDLSAIFAMLPSASTAVLQFKLTMCKSVL 81 LIN+TSTTL+DLP+ + H+ S+ D ++A+ A LP S AVLQFKL + KS++ Sbjct: 297 LINLTSTTLVDLPMILNAVSNHISSLPSDGIAALLAALP-PSRAVLQFKLALYKSLI 352