BLASTX nr result
ID: Paeonia25_contig00042979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00042979 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD36050.1| glycoside hydrolase family 16 protein [Ceriporiop... 65 7e-09 gb|ESK92442.1| glycoside hydrolase family 16 protein [Moniliopht... 65 1e-08 gb|ETW76293.1| glycoside hydrolase family 16 protein [Heterobasi... 62 6e-08 gb|EIW53084.1| laminarinase [Trametes versicolor FP-101664 SS1] 62 8e-08 ref|XP_007310113.1| endo-beta-glucanase [Stereum hirsutum FP-916... 58 1e-06 ref|XP_007384050.1| glycoside hydrolase family 16 protein [Punct... 58 2e-06 gb|EPQ53381.1| endo-beta-glucanase [Gloeophyllum trabeum ATCC 11... 57 2e-06 gb|EPQ56434.1| laminarinase [Gloeophyllum trabeum ATCC 11539] 57 3e-06 ref|XP_007349027.1| glycoside hydrolase family 16 protein [Auric... 57 3e-06 ref|XP_007370886.1| 2 beta-glucanase [Dichomitus squalens LYAD-4... 57 3e-06 ref|XP_007310100.1| 2 beta-glucan [Stereum hirsutum FP-91666 SS1... 57 3e-06 ref|XP_001836738.2| glycosyl hydrolase family 16 [Coprinopsis ci... 57 3e-06 ref|XP_007371127.1| endo-beta-glucanase [Dichomitus squalens LYA... 55 8e-06 gb|EIW84068.1| glycoside hydrolase family 16 protein [Coniophora... 55 8e-06 >gb|EMD36050.1| glycoside hydrolase family 16 protein [Ceriporiopsis subvermispora B] Length = 316 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 VIN+ LCGDWAG+ CVDYVN NPSAF+EAYFDF+WLKIY Sbjct: 266 VINLTLCGDWAGSS-SVYADAGCPSSCVDYVNENPSAFTEAYFDFQWLKIY 315 >gb|ESK92442.1| glycoside hydrolase family 16 protein [Moniliophthora roreri MCA 2997] Length = 312 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 VIN+ CGDWAG+V+ VDYVN+NPSAF +AYFDF WLKIY Sbjct: 264 VINLTFCGDWAGSVYGNSGCPSSC---VDYVNNNPSAFRDAYFDFAWLKIY 311 >gb|ETW76293.1| glycoside hydrolase family 16 protein [Heterobasidion irregulare TC 32-1] Length = 317 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +IN+ CGDWAGNV+ VDYVN+NPSAF AYF+F W+K+Y Sbjct: 269 IINLTFCGDWAGNVYASSGCPSTC---VDYVNNNPSAFVNAYFEFPWVKVY 316 >gb|EIW53084.1| laminarinase [Trametes versicolor FP-101664 SS1] Length = 314 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +IN+ LCGDWAG VF VD+VN+NPSAF+ A+FD +WLKIY Sbjct: 266 IINLTLCGDWAGAVFNQDGCSGNC---VDFVNNNPSAFTNAFFDIQWLKIY 313 >ref|XP_007310113.1| endo-beta-glucanase [Stereum hirsutum FP-91666 SS1] gi|389739438|gb|EIM80631.1| endo-beta-glucanase [Stereum hirsutum FP-91666 SS1] Length = 314 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +IN+ CGDWAG V+ DYVN NPSAF+ AYF+F W+K+Y Sbjct: 266 IINLTFCGDWAGAVYGNSGCPSTCN---DYVNKNPSAFNNAYFEFPWVKVY 313 >ref|XP_007384050.1| glycoside hydrolase family 16 protein [Punctularia strigosozonata HHB-11173 SS5] gi|390599957|gb|EIN09353.1| glycoside hydrolase family 16 protein [Punctularia strigosozonata HHB-11173 SS5] Length = 334 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/51 (49%), Positives = 31/51 (60%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +IN+ CGDWAG+ + VDYVN+NPSAF AYFD W+ IY Sbjct: 286 IINLTFCGDWAGSAYGSSGCPGTC---VDYVNNNPSAFQNAYFDLAWMNIY 333 >gb|EPQ53381.1| endo-beta-glucanase [Gloeophyllum trabeum ATCC 11539] Length = 318 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIYS 54 +IN+ CGDWAG+V+ VDYVN+NPSAF+ AYFDF +++Y+ Sbjct: 270 IINLTFCGDWAGSVYSSSGCPGSC---VDYVNNNPSAFNNAYFDFAAIRVYT 318 >gb|EPQ56434.1| laminarinase [Gloeophyllum trabeum ATCC 11539] Length = 317 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIYS 54 +IN+ CGDWAG V+ VDYVN+NPSAF+ AYFDF ++IY+ Sbjct: 269 IINLTFCGDWAGAVYSSDGCPGTC---VDYVNNNPSAFANAYFDFAGIRIYT 317 >ref|XP_007349027.1| glycoside hydrolase family 16 protein [Auricularia delicata TFB-10046 SS5] gi|393235254|gb|EJD42810.1| glycoside hydrolase family 16 protein [Auricularia delicata TFB-10046 SS5] Length = 314 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIYS 54 +IN+ LCGDWAG+V+ YVN+NPSAFS AYFDF+ L++Y+ Sbjct: 264 IINLTLCGDWAGSVWGSSACASNGACDA-YVNNNPSAFSNAYFDFKGLRVYA 314 >ref|XP_007370886.1| 2 beta-glucanase [Dichomitus squalens LYAD-421 SS1] gi|395323927|gb|EJF56379.1| 2 beta-glucanase [Dichomitus squalens LYAD-421 SS1] Length = 313 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/51 (50%), Positives = 30/51 (58%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +IN+ CGDWAG VF YVN NP+AF+ AYFD WLKIY Sbjct: 265 IINLTFCGDWAGAVFDSDNCPGDC---ATYVNENPAAFTNAYFDIAWLKIY 312 >ref|XP_007310100.1| 2 beta-glucan [Stereum hirsutum FP-91666 SS1] gi|389739424|gb|EIM80617.1| 2 beta-glucan [Stereum hirsutum FP-91666 SS1] Length = 314 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +IN+ CGDWAG V+ DYV++NPSAF+ AYF+F W+K+Y Sbjct: 266 IINLTFCGDWAGAVYANSGCPSTCD---DYVDNNPSAFNNAYFEFPWVKVY 313 >ref|XP_001836738.2| glycosyl hydrolase family 16 [Coprinopsis cinerea okayama7#130] gi|298408890|gb|EAU84955.2| glycosyl hydrolase family 16 [Coprinopsis cinerea okayama7#130] Length = 385 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 +INI LCGDWAGNVF VDYVN+NP AF +A+FD ++IY Sbjct: 337 IINITLCGDWAGNVFSQSGCPGTC---VDYVNNNPGAFEKAFFDMGAVRIY 384 >ref|XP_007371127.1| endo-beta-glucanase [Dichomitus squalens LYAD-421 SS1] gi|395323663|gb|EJF56125.1| endo-beta-glucanase [Dichomitus squalens LYAD-421 SS1] Length = 315 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/51 (50%), Positives = 30/51 (58%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 VIN+ CGDWAG VF YV+ NPSAF+ AYFD WLK+Y Sbjct: 267 VINLTFCGDWAGAVFAADGCPGDC---TTYVDENPSAFTNAYFDVAWLKVY 314 >gb|EIW84068.1| glycoside hydrolase family 16 protein [Coniophora puteana RWD-64-598 SS2] Length = 312 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 209 VINIDLCGDWAGNVFXXXXXXXXXXXCVDYVNSNPSAFSEAYFDFEWLKIY 57 VIN+ CGDWAGN CVDYVN+NPS FS+AYF+F L IY Sbjct: 262 VINLAFCGDWAGNA-QDYSAAGCPSDCVDYVNNNPSTFSDAYFEFNSLNIY 311