BLASTX nr result
ID: Paeonia25_contig00042821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00042821 (522 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007392706.1| hypothetical protein PHACADRAFT_26171 [Phane... 59 7e-07 >ref|XP_007392706.1| hypothetical protein PHACADRAFT_26171 [Phanerochaete carnosa HHB-10118-sp] gi|409048022|gb|EKM57500.1| hypothetical protein PHACADRAFT_26171 [Phanerochaete carnosa HHB-10118-sp] Length = 388 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -1 Query: 408 CNFTIAVVVY-DWILTFPDEFRLVWKRKLTGARILFLLNRYLFLSFNLTQVIN 253 C + AV+++ D+I+TF DE LVW+RKLTGA ILFLLNRY L N+ + N Sbjct: 19 CGVSSAVILFWDYIITFGDEINLVWRRKLTGATILFLLNRYASLIKNVVEFSN 71