BLASTX nr result
ID: Paeonia25_contig00042516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00042516 (492 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208485.1| hypothetical protein PRUPE_ppa018558mg [Prun... 56 4e-06 ref|XP_006294508.1| hypothetical protein CARUB_v10023540mg [Caps... 56 6e-06 ref|XP_002522559.1| cysteine protease, putative [Ricinus communi... 56 6e-06 ref|XP_007025413.1| Maternal effect embryo arrest 18 [Theobroma ... 55 8e-06 >ref|XP_007208485.1| hypothetical protein PRUPE_ppa018558mg [Prunus persica] gi|462404127|gb|EMJ09684.1| hypothetical protein PRUPE_ppa018558mg [Prunus persica] Length = 217 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 4/39 (10%) Frame = -1 Query: 399 HFMLIVGYGTDDDETKFWTIKNSWGED----GFMRLERD 295 H + IVGYGT DD K+W IKNSWGED G+MRL+RD Sbjct: 159 HAVTIVGYGTSDDGVKYWLIKNSWGEDWGERGYMRLQRD 197 >ref|XP_006294508.1| hypothetical protein CARUB_v10023540mg [Capsella rubella] gi|482563216|gb|EOA27406.1| hypothetical protein CARUB_v10023540mg [Capsella rubella] Length = 349 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/43 (55%), Positives = 31/43 (72%), Gaps = 4/43 (9%) Frame = -1 Query: 399 HFMLIVGYGTDDDETKFWTIKNS----WGEDGFMRLERDRNTP 283 H + IVGYG +D TK+W +KNS WGEDGFMR++RD + P Sbjct: 292 HAVTIVGYGMSEDGTKYWLVKNSWGETWGEDGFMRIKRDVDAP 334 >ref|XP_002522559.1| cysteine protease, putative [Ricinus communis] gi|223538250|gb|EEF39859.1| cysteine protease, putative [Ricinus communis] Length = 344 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/39 (58%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = -1 Query: 399 HFMLIVGYGTDDDETKFWTIKN----SWGEDGFMRLERD 295 H + +VGYGT DD TK+W +KN SWGEDG++R+ERD Sbjct: 287 HGVTVVGYGTSDDGTKYWLVKNSWGTSWGEDGYIRMERD 325 >ref|XP_007025413.1| Maternal effect embryo arrest 18 [Theobroma cacao] gi|508780779|gb|EOY28035.1| Maternal effect embryo arrest 18 [Theobroma cacao] Length = 1085 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Frame = -1 Query: 399 HFMLIVGYGTDDDETKFWTIKN----SWGEDGFMRLERDRNTP 283 H + I+GYGT +D TK+W IKN SWGE+G+MR++RD + P Sbjct: 708 HAVTIIGYGTSEDGTKYWLIKNSWGQSWGENGYMRIQRDVDNP 750