BLASTX nr result
ID: Paeonia25_contig00041146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041146 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera] 60 3e-07 >emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera] Length = 160 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 219 LASLTAFVILISNMDCQHLPPISPRPLCLSQFALVNHACSLLPSIP 82 L LT ++L +DCQ +PP SPRPLC+SQFALVNHAC++LP P Sbjct: 9 LMILTILLVLTLKVDCQLMPP-SPRPLCISQFALVNHACAMLPFNP 53