BLASTX nr result
ID: Paeonia25_contig00040303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040303 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602560.1| Protein kinase [Medicago truncatula] gi|3554... 65 1e-08 ref|XP_007048289.1| No lysine kinase 6 isoform 1 [Theobroma caca... 59 5e-07 ref|XP_002533407.1| kinase, putative [Ricinus communis] gi|22352... 57 4e-06 >ref|XP_003602560.1| Protein kinase [Medicago truncatula] gi|355491608|gb|AES72811.1| Protein kinase [Medicago truncatula] Length = 675 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +1 Query: 1 SLFDENEDEELRSEIEKIEVQYQEALKDLCKKRHGAIVEAKERLSQKKIVI 153 S F E EDE LR E+EKIE QYQEA+KDLCK+RH A++E ++RLSQK +I Sbjct: 625 SSFHEAEDE-LRIELEKIERQYQEAMKDLCKRRHDAMMETRKRLSQKNSII 674 >ref|XP_007048289.1| No lysine kinase 6 isoform 1 [Theobroma cacao] gi|590708482|ref|XP_007048290.1| No lysine kinase 6 isoform 1 [Theobroma cacao] gi|508700550|gb|EOX92446.1| No lysine kinase 6 isoform 1 [Theobroma cacao] gi|508700551|gb|EOX92447.1| No lysine kinase 6 isoform 1 [Theobroma cacao] Length = 696 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +1 Query: 22 DEELRSEIEKIEVQYQEALKDLCKKRHGAIVEAKERLSQKK 144 DEELR E+E IE+QYQEA+K++ KKRH AI++ + RLSQKK Sbjct: 608 DEELRLELEMIELQYQEAMKEISKKRHEAIMDTRRRLSQKK 648 >ref|XP_002533407.1| kinase, putative [Ricinus communis] gi|223526752|gb|EEF28980.1| kinase, putative [Ricinus communis] Length = 662 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +1 Query: 4 LFDENEDEELRSEIEKIEVQYQEALKDLCKKRHGAIVEAKERLS 135 L ++NE ELR E+EKIE+QYQEA+K++ ++RH AI+E +RLS Sbjct: 619 LSNKNESNELREELEKIELQYQEAIKEIIRQRHKAIIETTKRLS 662