BLASTX nr result
ID: Paeonia25_contig00040008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040008 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing pro... 59 7e-07 ref|XP_004287919.1| PREDICTED: SPX and EXS domain-containing pro... 57 3e-06 >ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] gi|449480887|ref|XP_004156022.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] Length = 477 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 VENEWNKMTSKSNSPITMADIPTEEDRLLN*NDHNV 108 VENEWNKM SKSN ITM+++PTEED+LLN ++HNV Sbjct: 442 VENEWNKMNSKSNIQITMSNLPTEEDKLLNSSNHNV 477 >ref|XP_004287919.1| PREDICTED: SPX and EXS domain-containing protein 5-like [Fragaria vesca subsp. vesca] Length = 482 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 VENEWNKMTSKSNSPITMADIPTEEDRLLN*NDHNV 108 VENEW KM+SKSN ++M+DIP EEDRLLN N HNV Sbjct: 447 VENEWIKMSSKSNFQLSMSDIPNEEDRLLNSNGHNV 482