BLASTX nr result
ID: Paeonia25_contig00039903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039903 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM04544.1| predicted protein [Fibroporia radiculosa] 57 2e-06 >emb|CCM04544.1| predicted protein [Fibroporia radiculosa] Length = 765 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +2 Query: 11 RSRAGSRGTETSDTETFPLGGTRAKEERRKQVEIQMQMPYTPPSGTRAA 157 R R+G R T +SDT++ P+ GTRA+EE+ + VE + PYTPP GTRAA Sbjct: 699 RRRSGPRLTGSSDTDSVPMQGTRAREEKVRMVEELQRTPYTPPRGTRAA 747