BLASTX nr result
ID: Paeonia25_contig00039884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039884 (1197 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS99496.1| hypothetical protein FOMPIDRAFT_82673 [Fomitopsis... 59 5e-06 ref|XP_003035322.1| cytolysin [Schizophyllum commune H4-8] gi|30... 58 7e-06 >gb|EPS99496.1| hypothetical protein FOMPIDRAFT_82673 [Fomitopsis pinicola FP-58527 SS1] Length = 290 Score = 58.5 bits (140), Expect = 5e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +2 Query: 2 WYSYNTVLGTPYRLGTTHSQSSREEIAWVHDNSHGPDSFTDTWTE 136 W+SYN V+G PY L + SR+E AW +DNS +SFTD+WTE Sbjct: 51 WWSYNVVIGKPYILSRVPNAVSRDETAWRYDNSQNSESFTDSWTE 95 >ref|XP_003035322.1| cytolysin [Schizophyllum commune H4-8] gi|300109018|gb|EFJ00420.1| cytolysin [Schizophyllum commune H4-8] Length = 291 Score = 58.2 bits (139), Expect = 7e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +2 Query: 2 WYSYNTVLGTPYRLGTTHSQSSREEIAWVHDNSHGPDSFTDTWTE 136 W+SYNT +G PY LG +REE+AW +DN+ + +TD WTE Sbjct: 51 WWSYNTTIGKPYVLGRVPKDITREEVAWSYDNTKNTEDYTDEWTE 95