BLASTX nr result
ID: Paeonia25_contig00039716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039716 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526975.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >ref|XP_002526975.1| conserved hypothetical protein [Ricinus communis] gi|223533666|gb|EEF35402.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/64 (48%), Positives = 40/64 (62%) Frame = -2 Query: 211 MKSPKSVPHNYQEPYIRSRQNPYFNGLVRSDAALMDRATTFVFEQSAGSRNISRSASDIG 32 MKS + QEPYIR+R+NPYF GL R D A ++ T F+ + SRNISR+ S+I Sbjct: 1 MKSSAGIRSLQQEPYIRTRENPYFTGLRRGDIASRNQTPTLDFQGNDASRNISRTTSEIS 60 Query: 31 DTRS 20 RS Sbjct: 61 HARS 64