BLASTX nr result
ID: Paeonia25_contig00039657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039657 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO04163.1| transcription factor Gf.BMR1 [Grifola frondosa] 49 9e-11 ref|XP_007389272.1| hypothetical protein PUNSTDRAFT_123274 [Punc... 48 2e-10 ref|XP_007263017.1| hypothetical protein FOMMEDRAFT_165461 [Fomi... 48 2e-10 gb|ESK86272.1| c6 transcription factor [Moniliophthora roreri MC... 48 2e-10 gb|EIW83618.1| hypothetical protein CONPUDRAFT_88151 [Coniophora... 48 1e-09 ref|XP_001882202.1| predicted protein [Laccaria bicolor S238N-H8... 48 1e-09 gb|ABU50336.1| putative zinc finger/binuclear cluster transcript... 48 1e-09 ref|XP_007299511.1| hypothetical protein STEHIDRAFT_107349 [Ster... 45 2e-09 ref|XP_007342814.1| hypothetical protein AURDEDRAFT_161853 [Auri... 49 6e-09 ref|XP_003028806.1| hypothetical protein SCHCODRAFT_269956 [Schi... 45 7e-08 gb|EUC56972.1| fungal Zn, 2-cys(6) binuclear cluster domain prot... 45 2e-07 gb|EUC64807.1| urate oxidase [Rhizoctonia solani AG-3 Rhs1AP] 47 1e-06 emb|CCO28921.1| urate oxidase [Rhizoctonia solani AG-1 IB] 47 1e-06 >dbj|BAO04163.1| transcription factor Gf.BMR1 [Grifola frondosa] Length = 745 Score = 49.3 bits (116), Expect(2) = 9e-11 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 334 MAGDHKVNSPLTHSRTRLSHTFSFSPQCPVCQSTFTRPQHVARHMRS 194 MAGDHK CPVCQSTFTRPQHVARHMRS Sbjct: 1 MAGDHK---------------------CPVCQSTFTRPQHVARHMRS 26 Score = 42.7 bits (99), Expect(2) = 9e-11 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQHCGDQFA Sbjct: 28 TGDRPYKCQHCGDQFA 43 >ref|XP_007389272.1| hypothetical protein PUNSTDRAFT_123274 [Punctularia strigosozonata HHB-11173 SS5] gi|390594085|gb|EIN03500.1| hypothetical protein PUNSTDRAFT_123274 [Punctularia strigosozonata HHB-11173 SS5] Length = 921 Score = 48.1 bits (113), Expect(2) = 2e-10 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 334 MAGDHKVNSPLTHSRTRLSHTFSFSPQCPVCQSTFTRPQHVARHMRS 194 MAGDHK CPVCQ+TFTRPQHVARHMRS Sbjct: 1 MAGDHK---------------------CPVCQATFTRPQHVARHMRS 26 Score = 42.7 bits (99), Expect(2) = 2e-10 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQHCGDQFA Sbjct: 28 TGDRPYKCQHCGDQFA 43 >ref|XP_007263017.1| hypothetical protein FOMMEDRAFT_165461 [Fomitiporia mediterranea MF3/22] gi|393221268|gb|EJD06753.1| hypothetical protein FOMMEDRAFT_165461 [Fomitiporia mediterranea MF3/22] Length = 802 Score = 48.1 bits (113), Expect(2) = 2e-10 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -1 Query: 334 MAGDHKVNSPLTHSRTRLSHTFSFSPQCPVCQSTFTRPQHVARHMRS 194 MAGDHK CPVCQ+TFTRPQHVARHMRS Sbjct: 1 MAGDHK---------------------CPVCQATFTRPQHVARHMRS 26 Score = 42.7 bits (99), Expect(2) = 2e-10 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQHCGDQFA Sbjct: 28 TGDRPYKCQHCGDQFA 43 >gb|ESK86272.1| c6 transcription factor [Moniliophthora roreri MCA 2997] Length = 851 Score = 47.8 bits (112), Expect(2) = 2e-10 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = -1 Query: 256 QCPVCQSTFTRPQHVARHMRS 194 +CPVCQ+TFTRPQHVARHMRS Sbjct: 6 KCPVCQATFTRPQHVARHMRS 26 Score = 42.7 bits (99), Expect(2) = 2e-10 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQHCGDQFA Sbjct: 28 TGDRPYKCQHCGDQFA 43 >gb|EIW83618.1| hypothetical protein CONPUDRAFT_88151 [Coniophora puteana RWD-64-598 SS2] Length = 834 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = -1 Query: 256 QCPVCQSTFTRPQHVARHMRS 194 +CPVCQ+TFTRPQHVARHMRS Sbjct: 6 KCPVCQATFTRPQHVARHMRS 26 Score = 40.4 bits (93), Expect(2) = 1e-09 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQ+CGDQFA Sbjct: 28 TGDRPYKCQYCGDQFA 43 >ref|XP_001882202.1| predicted protein [Laccaria bicolor S238N-H82] gi|164643017|gb|EDR07271.1| predicted protein [Laccaria bicolor S238N-H82] Length = 834 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = -1 Query: 256 QCPVCQSTFTRPQHVARHMRS 194 +CPVCQ+TFTRPQHVARHMRS Sbjct: 6 KCPVCQATFTRPQHVARHMRS 26 Score = 40.4 bits (93), Expect(2) = 1e-09 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQ+CGDQFA Sbjct: 28 TGDRPYKCQYCGDQFA 43 >gb|ABU50336.1| putative zinc finger/binuclear cluster transcriptional regulator [Armillaria mellea] Length = 517 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = -1 Query: 256 QCPVCQSTFTRPQHVARHMRS 194 +CPVCQ+TFTRPQHVARHMRS Sbjct: 6 KCPVCQATFTRPQHVARHMRS 26 Score = 40.4 bits (93), Expect(2) = 1e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKC HCGDQFA Sbjct: 28 TGDRPYKCTHCGDQFA 43 >ref|XP_007299511.1| hypothetical protein STEHIDRAFT_107349 [Stereum hirsutum FP-91666 SS1] gi|389749398|gb|EIM90569.1| hypothetical protein STEHIDRAFT_107349 [Stereum hirsutum FP-91666 SS1] Length = 900 Score = 45.1 bits (105), Expect(2) = 2e-09 Identities = 24/47 (51%), Positives = 25/47 (53%) Frame = -1 Query: 334 MAGDHKVNSPLTHSRTRLSHTFSFSPQCPVCQSTFTRPQHVARHMRS 194 MAGDHK C VCQ+TFTRPQHVARHMRS Sbjct: 1 MAGDHK---------------------CSVCQATFTRPQHVARHMRS 26 Score = 42.7 bits (99), Expect(2) = 2e-09 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKCQHCGDQFA Sbjct: 28 TGDRPYKCQHCGDQFA 43 >ref|XP_007342814.1| hypothetical protein AURDEDRAFT_161853 [Auricularia delicata TFB-10046 SS5] gi|393241393|gb|EJD48915.1| hypothetical protein AURDEDRAFT_161853 [Auricularia delicata TFB-10046 SS5] Length = 778 Score = 49.3 bits (116), Expect(2) = 6e-09 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 334 MAGDHKVNSPLTHSRTRLSHTFSFSPQCPVCQSTFTRPQHVARHMRS 194 MAGDHK CPVCQSTFTRPQHVARHMRS Sbjct: 1 MAGDHK---------------------CPVCQSTFTRPQHVARHMRS 26 Score = 36.6 bits (83), Expect(2) = 6e-09 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKC CGDQFA Sbjct: 28 TGDRPYKCTTCGDQFA 43 >ref|XP_003028806.1| hypothetical protein SCHCODRAFT_269956 [Schizophyllum commune H4-8] gi|300102495|gb|EFI93903.1| hypothetical protein SCHCODRAFT_269956 [Schizophyllum commune H4-8] Length = 900 Score = 44.7 bits (104), Expect(2) = 7e-08 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -1 Query: 256 QCPVCQSTFTRPQHVARHMRS 194 +C VCQ+TFTRPQHVARHMRS Sbjct: 6 KCSVCQATFTRPQHVARHMRS 26 Score = 37.4 bits (85), Expect(2) = 7e-08 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPYKC CGDQFA Sbjct: 28 TGDRPYKCPQCGDQFA 43 >gb|EUC56972.1| fungal Zn, 2-cys(6) binuclear cluster domain protein [Rhizoctonia solani AG-3 Rhs1AP] Length = 662 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -1 Query: 253 CPVCQSTFTRPQHVARHMRS 194 CPVC +TFTRPQHVARHMRS Sbjct: 7 CPVCSATFTRPQHVARHMRS 26 Score = 35.0 bits (79), Expect(2) = 2e-07 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 116 TGDRPYKCQHCGDQFA 69 TGDRPY CQ CGD+FA Sbjct: 28 TGDRPYACQTCGDRFA 43 >gb|EUC64807.1| urate oxidase [Rhizoctonia solani AG-3 Rhs1AP] Length = 532 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 Query: 253 CPVCQSTFTRPQHVARHMRS 194 CPVCQ+TFTRPQHVARHMRS Sbjct: 7 CPVCQATFTRPQHVARHMRS 26 Score = 30.8 bits (68), Expect(2) = 1e-06 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 116 TGDRPYKCQHCGDQF 72 TGDRPYKC C D F Sbjct: 28 TGDRPYKCSVCNDSF 42 >emb|CCO28921.1| urate oxidase [Rhizoctonia solani AG-1 IB] Length = 538 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 Query: 253 CPVCQSTFTRPQHVARHMRS 194 CPVCQ+TFTRPQHVARHMRS Sbjct: 7 CPVCQATFTRPQHVARHMRS 26 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 116 TGDRPYKCQHCGDQF 72 TGDRPYKC C D F Sbjct: 28 TGDRPYKCPVCNDSF 42