BLASTX nr result
ID: Paeonia25_contig00039628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039628 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007308289.1| hypothetical protein STEHIDRAFT_141346 [Ster... 68 1e-09 ref|XP_002473877.1| hypothetical protein POSPLDRAFT_95888 [Posti... 68 2e-09 ref|XP_007391540.1| hypothetical protein PHACADRAFT_249086 [Phan... 67 3e-09 emb|CCM02597.1| predicted protein [Fibroporia radiculosa] 65 1e-08 ref|XP_007270693.1| glycopeptide [Fomitiporia mediterranea MF3/2... 64 2e-08 ref|XP_007308290.1| hypothetical protein STEHIDRAFT_182876 [Ster... 64 2e-08 ref|XP_007313735.1| hypothetical protein SERLADRAFT_354072 [Serp... 64 2e-08 ref|XP_002473876.1| hypothetical protein POSPLDRAFT_95887 [Posti... 63 5e-08 gb|EPS96030.1| hypothetical protein FOMPIDRAFT_146097 [Fomitopsi... 62 6e-08 gb|EPT01254.1| hypothetical protein FOMPIDRAFT_1161879 [Fomitops... 62 1e-07 gb|EPT01244.1| hypothetical protein FOMPIDRAFT_84905 [Fomitopsis... 61 1e-07 gb|EPT01256.1| hypothetical protein FOMPIDRAFT_1048972 [Fomitops... 60 3e-07 ref|XP_007270692.1| glycopeptide [Fomitiporia mediterranea MF3/2... 60 4e-07 dbj|BAF46901.1| glycopeptide [Phanerochaete chrysosporium] 60 4e-07 emb|CCM01442.1| predicted protein [Fibroporia radiculosa] 59 5e-07 ref|XP_007368127.1| glycopeptide [Dichomitus squalens LYAD-421 S... 59 7e-07 gb|EPT05666.1| hypothetical protein FOMPIDRAFT_1027255 [Fomitops... 59 9e-07 ref|XP_007361911.1| glycopeptide [Dichomitus squalens LYAD-421 S... 59 9e-07 ref|XP_007364771.1| hypothetical protein DICSQDRAFT_169088 [Dich... 58 2e-06 dbj|BAF46900.1| glycopeptide [Phanerochaete chrysosporium] 58 2e-06 >ref|XP_007308289.1| hypothetical protein STEHIDRAFT_141346 [Stereum hirsutum FP-91666 SS1] gi|389741971|gb|EIM83159.1| hypothetical protein STEHIDRAFT_141346 [Stereum hirsutum FP-91666 SS1] Length = 158 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AE+HT+ FVNNCGFGTP L +QSG ILS GG+ T G ++GAIAY Sbjct: 22 AETHTINFVNNCGFGTPTLVSQSGQILSTGGTYTAGGAIVGAIAY 66 >ref|XP_002473877.1| hypothetical protein POSPLDRAFT_95888 [Postia placenta Mad-698-R] gi|220726977|gb|EED80910.1| hypothetical protein POSPLDRAFT_95888 [Postia placenta Mad-698-R] Length = 131 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIA 32 AESHTVTF N CG+GTP LRA +G++LS GGS T NG L+GAIA Sbjct: 21 AESHTVTFNNRCGYGTPYLRASNGAVLSTGGSYTSNGALVGAIA 64 >ref|XP_007391540.1| hypothetical protein PHACADRAFT_249086 [Phanerochaete carnosa HHB-10118-sp] gi|409049477|gb|EKM58954.1| hypothetical protein PHACADRAFT_249086 [Phanerochaete carnosa HHB-10118-sp] Length = 160 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHTVTFVNNCGFGTP+L+A +G LS GGS+T G LI AIA+ Sbjct: 22 AESHTVTFVNNCGFGTPLLKA-NGQTLSTGGSVTFGGSLISAIAF 65 >emb|CCM02597.1| predicted protein [Fibroporia radiculosa] Length = 138 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 A+ HTV+F NNCG+GTP L A+SG++LS+G +T+NG LIGA+A+ Sbjct: 10 ADMHTVSFTNNCGYGTPNLVAESGTLLSDGAPLTMNGPLIGAVAF 54 >ref|XP_007270693.1| glycopeptide [Fomitiporia mediterranea MF3/22] gi|393213582|gb|EJC99078.1| glycopeptide [Fomitiporia mediterranea MF3/22] Length = 155 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHTV F NNCGFGTP L Q ++LS GG TING LIGAIAY Sbjct: 18 AESHTVHFTNNCGFGTPTL-IQGPNVLSTGGDFTINGPLIGAIAY 61 >ref|XP_007308290.1| hypothetical protein STEHIDRAFT_182876 [Stereum hirsutum FP-91666 SS1] gi|389741972|gb|EIM83160.1| hypothetical protein STEHIDRAFT_182876 [Stereum hirsutum FP-91666 SS1] Length = 158 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHT+TF N CG+GTP L +QSG ILS GG+ G +IGAIAY Sbjct: 22 AESHTITFANYCGYGTPTLVSQSGQILSTGGAYNAGGPIIGAIAY 66 >ref|XP_007313735.1| hypothetical protein SERLADRAFT_354072 [Serpula lacrymans var. lacrymans S7.9] gi|336375287|gb|EGO03623.1| hypothetical protein SERLA73DRAFT_83713 [Serpula lacrymans var. lacrymans S7.3] gi|336388349|gb|EGO29493.1| hypothetical protein SERLADRAFT_354072 [Serpula lacrymans var. lacrymans S7.9] Length = 160 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHTVTF NNCG+GTP L Q+G++LS GG+ T NG L GAIAY Sbjct: 22 AESHTVTFSNNCGYGTPTL-IQNGNVLSTGGAYTSNGPLTGAIAY 65 >ref|XP_002473876.1| hypothetical protein POSPLDRAFT_95887 [Postia placenta Mad-698-R] gi|220726976|gb|EED80909.1| hypothetical protein POSPLDRAFT_95887 [Postia placenta Mad-698-R] Length = 166 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIA 32 AESHTV F N C FGTPILRA G ILS GG T +G L+GAIA Sbjct: 21 AESHTVIFTNKCDFGTPILRASDGEILSVGGDYTSDGALVGAIA 64 >gb|EPS96030.1| hypothetical protein FOMPIDRAFT_146097 [Fomitopsis pinicola FP-58527 SS1] Length = 155 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHTV+F NNCG GTPILR+Q+G +LS+G T +G L GA AY Sbjct: 21 AESHTVSFSNNCGTGTPILRSQNGVVLSQGEDYTSSGSLDGAFAY 65 >gb|EPT01254.1| hypothetical protein FOMPIDRAFT_1161879 [Fomitopsis pinicola FP-58527 SS1] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AE+HTVTF N CG+GTP L +Q+G +LS GG+ T NG +G IAY Sbjct: 20 AETHTVTFTNKCGYGTPTLYSQTGQLLSTGGAWTSNGAALGLIAY 64 >gb|EPT01244.1| hypothetical protein FOMPIDRAFT_84905 [Fomitopsis pinicola FP-58527 SS1] Length = 152 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AE+HTVTF N CG GTP LR+Q+G +LS GG+ T NG +G IAY Sbjct: 18 AETHTVTFNNKCGRGTPYLRSQTGEVLSTGGAWTSNGPALGLIAY 62 >gb|EPT01256.1| hypothetical protein FOMPIDRAFT_1048972 [Fomitopsis pinicola FP-58527 SS1] Length = 154 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHTVTF N+CG GTP L++Q+G LS GG+ T +G +G IAY Sbjct: 21 AESHTVTFTNHCGKGTPTLKSQNGQTLSTGGAYTSDGAALGLIAY 65 >ref|XP_007270692.1| glycopeptide [Fomitiporia mediterranea MF3/22] gi|393213581|gb|EJC99077.1| glycopeptide [Fomitiporia mediterranea MF3/22] Length = 155 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AESHTV F NNCGFGTP+L Q ++LS GG TI G L GAIAY Sbjct: 18 AESHTVHFTNNCGFGTPML-IQGPNVLSTGGDFTIGGPLEGAIAY 61 >dbj|BAF46901.1| glycopeptide [Phanerochaete chrysosporium] Length = 160 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AE+HTV+F NNCGFGTP+L A G LS G +TING L+ AIA+ Sbjct: 22 AETHTVSFANNCGFGTPLLMA-GGQTLSHGEPVTINGPLVAAIAF 65 >emb|CCM01442.1| predicted protein [Fibroporia radiculosa] Length = 155 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 160 ESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 ESHTVTF NNCG+GTP L G++LS GG+ T NG G IAY Sbjct: 22 ESHTVTFTNNCGYGTPYLWGPDGALLSTGGAYTSNGPADGLIAY 65 >ref|XP_007368127.1| glycopeptide [Dichomitus squalens LYAD-421 SS1] gi|395326776|gb|EJF59182.1| glycopeptide [Dichomitus squalens LYAD-421 SS1] Length = 159 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -1 Query: 166 MAESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 +AE+H V F NNCGFGTP L Q+G+ILS+G ++ I G LI AIAY Sbjct: 20 LAETHIVQFTNNCGFGTPTL-LQNGNILSQGATVEIEGALISAIAY 64 >gb|EPT05666.1| hypothetical protein FOMPIDRAFT_1027255 [Fomitopsis pinicola FP-58527 SS1] Length = 156 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AE HTV+F N CG GTP L+ Q+G LS GG+ T +GE +G IAY Sbjct: 21 AEQHTVSFTNKCGHGTPTLKGQNGQTLSTGGAWTSSGEALGLIAY 65 >ref|XP_007361911.1| glycopeptide [Dichomitus squalens LYAD-421 SS1] gi|395332897|gb|EJF65275.1| glycopeptide [Dichomitus squalens LYAD-421 SS1] Length = 157 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -1 Query: 166 MAESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 +AE+HT+TF N CGFGTP L Q+G +LS GG+ T NG + AIAY Sbjct: 19 LAETHTITFDNRCGFGTPTL-IQNGQVLSTGGAYTTNGPITAAIAY 63 >ref|XP_007364771.1| hypothetical protein DICSQDRAFT_169088 [Dichomitus squalens LYAD-421 SS1] gi|395330314|gb|EJF62698.1| hypothetical protein DICSQDRAFT_169088 [Dichomitus squalens LYAD-421 SS1] Length = 159 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -1 Query: 166 MAESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 +AESHTVTF N CG GTP L Q+G ILS GG+ NG L+ AIAY Sbjct: 20 LAESHTVTFNNRCGHGTPTL-VQNGRILSTGGNYVSNGPLVAAIAY 64 >dbj|BAF46900.1| glycopeptide [Phanerochaete chrysosporium] Length = 160 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 163 AESHTVTFVNNCGFGTPILRAQSGSILSEGGSITINGELIGAIAY 29 AE HTV+F NNCGFGTP+L+A +G LS G ++T G LI AIA+ Sbjct: 22 AEQHTVSFTNNCGFGTPLLKA-NGQTLSTGQTVTFGGPLISAIAF 65