BLASTX nr result
ID: Paeonia25_contig00038982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038982 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21331.1| hypothetical protein MIMGU_mgv1a000085mg [Mimulus... 80 2e-13 ref|XP_007217094.1| hypothetical protein PRUPE_ppa000094mg [Prun... 80 2e-13 ref|XP_002264494.2| PREDICTED: uncharacterized protein LOC100267... 80 4e-13 emb|CBI35883.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_006465928.1| PREDICTED: uncharacterized protein LOC102628... 78 1e-12 ref|XP_006426643.1| hypothetical protein CICLE_v10024687mg [Citr... 78 1e-12 ref|XP_007024605.1| B-block binding subunit of TFIIIC, putative ... 77 2e-12 ref|XP_007024604.1| B-block binding subunit of TFIIIC, putative ... 77 2e-12 ref|XP_006599735.1| PREDICTED: uncharacterized protein LOC100788... 75 7e-12 ref|XP_003549195.1| PREDICTED: uncharacterized protein LOC100788... 75 7e-12 ref|XP_004246882.1| PREDICTED: uncharacterized protein LOC101258... 74 2e-11 gb|EXC04959.1| hypothetical protein L484_002610 [Morus notabilis] 73 5e-11 ref|XP_002886680.1| hypothetical protein ARALYDRAFT_475365 [Arab... 71 2e-10 gb|AAF97311.1|AC007843_14 Hypothetical protein [Arabidopsis thal... 70 3e-10 ref|NP_001185022.1| B-block binding subunit of TFIIIC [Arabidops... 70 3e-10 ref|XP_002892952.1| hypothetical protein ARALYDRAFT_889150 [Arab... 70 3e-10 ref|XP_002521337.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 ref|XP_006303881.1| hypothetical protein CARUB_v10008077mg [Caps... 69 7e-10 ref|XP_007145384.1| hypothetical protein PHAVU_007G2346001g, par... 68 2e-09 ref|XP_006391048.1| hypothetical protein EUTSA_v10017997mg [Eutr... 68 2e-09 >gb|EYU21331.1| hypothetical protein MIMGU_mgv1a000085mg [Mimulus guttatus] Length = 1865 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV +G+ +D + HAI +A+ELKPYIEEP+STVAP SGS RP + Sbjct: 867 DILRRLKLIRLVREGHAEDGASSAHAILTNALELKPYIEEPVSTVAP-SGSVFSHLRPQV 925 Query: 182 RHDFIL 199 RHDF+L Sbjct: 926 RHDFVL 931 >ref|XP_007217094.1| hypothetical protein PRUPE_ppa000094mg [Prunus persica] gi|462413244|gb|EMJ18293.1| hypothetical protein PRUPE_ppa000094mg [Prunus persica] Length = 1843 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/66 (59%), Positives = 50/66 (75%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 +IL+RLKLIR+V+D +L+D VPHAI HA+E KPYIEEP+S A S S+D RP + Sbjct: 818 EILRRLKLIRMVSDEHLKDAIKVPHAISTHALEFKPYIEEPLSKDAISLSFRSVDLRPRI 877 Query: 182 RHDFIL 199 RHDF+L Sbjct: 878 RHDFVL 883 >ref|XP_002264494.2| PREDICTED: uncharacterized protein LOC100267761 [Vitis vinifera] Length = 1884 Score = 79.7 bits (195), Expect = 4e-13 Identities = 44/66 (66%), Positives = 52/66 (78%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV+ G+L+D ++V A KHA+ELKPYIEEP S VAPS S LD RP + Sbjct: 806 DILRRLKLIRLVS-GHLEDGAEVQRATLKHALELKPYIEEP-SLVAPSLCSSFLDLRPKI 863 Query: 182 RHDFIL 199 RHDFIL Sbjct: 864 RHDFIL 869 >emb|CBI35883.3| unnamed protein product [Vitis vinifera] Length = 1683 Score = 79.7 bits (195), Expect = 4e-13 Identities = 44/66 (66%), Positives = 52/66 (78%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV+ G+L+D ++V A KHA+ELKPYIEEP S VAPS S LD RP + Sbjct: 752 DILRRLKLIRLVS-GHLEDGAEVQRATLKHALELKPYIEEP-SLVAPSLCSSFLDLRPKI 809 Query: 182 RHDFIL 199 RHDFIL Sbjct: 810 RHDFIL 815 >ref|XP_006465928.1| PREDICTED: uncharacterized protein LOC102628666 isoform X1 [Citrus sinensis] gi|568823033|ref|XP_006465929.1| PREDICTED: uncharacterized protein LOC102628666 isoform X2 [Citrus sinensis] Length = 1499 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV++G+ + + + HA HAMELKPYIEEP TVA +S S SLD RP + Sbjct: 441 DILRRLKLIRLVSNGHSDNGTKILHANLTHAMELKPYIEEP-PTVATTSNSMSLDLRPRI 499 Query: 182 RHDFI 196 RHDFI Sbjct: 500 RHDFI 504 >ref|XP_006426643.1| hypothetical protein CICLE_v10024687mg [Citrus clementina] gi|557528633|gb|ESR39883.1| hypothetical protein CICLE_v10024687mg [Citrus clementina] Length = 1849 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV++G+ + + + HA HAMELKPYIEEP TVA +S S SLD RP + Sbjct: 791 DILRRLKLIRLVSNGHSDNGTKILHANLTHAMELKPYIEEP-PTVAATSNSMSLDLRPRI 849 Query: 182 RHDFI 196 RHDFI Sbjct: 850 RHDFI 854 >ref|XP_007024605.1| B-block binding subunit of TFIIIC, putative isoform 2 [Theobroma cacao] gi|508779971|gb|EOY27227.1| B-block binding subunit of TFIIIC, putative isoform 2 [Theobroma cacao] Length = 1648 Score = 77.4 bits (189), Expect = 2e-12 Identities = 43/67 (64%), Positives = 48/67 (71%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV +R VPHA HAMELKPYIEEP+S VA S+ S D RP + Sbjct: 808 DILRRLKLIRLVPGECSDNRVKVPHANLTHAMELKPYIEEPLSLVATST-FRSFDLRPRI 866 Query: 182 RHDFILL 202 RHDFILL Sbjct: 867 RHDFILL 873 >ref|XP_007024604.1| B-block binding subunit of TFIIIC, putative isoform 1 [Theobroma cacao] gi|508779970|gb|EOY27226.1| B-block binding subunit of TFIIIC, putative isoform 1 [Theobroma cacao] Length = 1845 Score = 77.4 bits (189), Expect = 2e-12 Identities = 43/67 (64%), Positives = 48/67 (71%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV +R VPHA HAMELKPYIEEP+S VA S+ S D RP + Sbjct: 808 DILRRLKLIRLVPGECSDNRVKVPHANLTHAMELKPYIEEPLSLVATST-FRSFDLRPRI 866 Query: 182 RHDFILL 202 RHDFILL Sbjct: 867 RHDFILL 873 >ref|XP_006599735.1| PREDICTED: uncharacterized protein LOC100788212 isoform X4 [Glycine max] Length = 1788 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/66 (59%), Positives = 45/66 (68%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIR++ D +D PH F H MEL+PYIEEP S APS SLD RP + Sbjct: 768 DILRRLKLIRMITDLQSRDGVKTPHT-FTHVMELRPYIEEPFSNDAPSLNFISLDLRPRI 826 Query: 182 RHDFIL 199 RHDFIL Sbjct: 827 RHDFIL 832 >ref|XP_003549195.1| PREDICTED: uncharacterized protein LOC100788212 isoform X1 [Glycine max] gi|571530435|ref|XP_006599733.1| PREDICTED: uncharacterized protein LOC100788212 isoform X2 [Glycine max] gi|571530438|ref|XP_006599734.1| PREDICTED: uncharacterized protein LOC100788212 isoform X3 [Glycine max] Length = 1794 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/66 (59%), Positives = 45/66 (68%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIR++ D +D PH F H MEL+PYIEEP S APS SLD RP + Sbjct: 768 DILRRLKLIRMITDLQSRDGVKTPHT-FTHVMELRPYIEEPFSNDAPSLNFISLDLRPRI 826 Query: 182 RHDFIL 199 RHDFIL Sbjct: 827 RHDFIL 832 >ref|XP_004246882.1| PREDICTED: uncharacterized protein LOC101258404 [Solanum lycopersicum] Length = 1854 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/66 (53%), Positives = 45/66 (68%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRLV G+ ++ +D+PH H +ELKPYIEEP+ V S D RP + Sbjct: 794 DILRRLKLIRLVCGGHPENTADLPHTTLTHTLELKPYIEEPVCLVGSSHSIHCPDLRPQI 853 Query: 182 RHDFIL 199 RHDF+L Sbjct: 854 RHDFVL 859 >gb|EXC04959.1| hypothetical protein L484_002610 [Morus notabilis] Length = 1765 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/66 (56%), Positives = 46/66 (69%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKL+R+V+ +D S + A F HAMELKPYIEEP+S A S LD RP + Sbjct: 816 DILRRLKLLRMVSGECAKDGSQLLQATFTHAMELKPYIEEPISKAAISLSFRLLDLRPRI 875 Query: 182 RHDFIL 199 RHDF+L Sbjct: 876 RHDFVL 881 >ref|XP_002886680.1| hypothetical protein ARALYDRAFT_475365 [Arabidopsis lyrata subsp. lyrata] gi|297332521|gb|EFH62939.1| hypothetical protein ARALYDRAFT_475365 [Arabidopsis lyrata subsp. lyrata] Length = 1738 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLI++V+D +D + +A HA+ELKPYIEEP+ VA S SLDFRP + Sbjct: 749 DILRRLKLIQMVSDRLRRDEIEEKYANLTHAVELKPYIEEPL-FVAAKSDVTSLDFRPRI 807 Query: 182 RHDFIL 199 RHDFIL Sbjct: 808 RHDFIL 813 >gb|AAF97311.1|AC007843_14 Hypothetical protein [Arabidopsis thaliana] Length = 1808 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLI++V+ +D + +A HAMELKPYIEEP+ VA +S SLDFRP + Sbjct: 781 DILRRLKLIQMVSSRLRRDEIEEKYANLTHAMELKPYIEEPV-FVAATSNVMSLDFRPRI 839 Query: 182 RHDFIL 199 RHDFIL Sbjct: 840 RHDFIL 845 >ref|NP_001185022.1| B-block binding subunit of TFIIIC [Arabidopsis thaliana] gi|332191469|gb|AEE29590.1| B-block binding subunit of TFIIIC [Arabidopsis thaliana] Length = 1844 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLI++V+ +D + +A HAMELKPYIEEP+ VA +S SLDFRP + Sbjct: 804 DILRRLKLIQMVSSRLRRDEIEEKYANLTHAMELKPYIEEPV-FVAATSNVMSLDFRPRI 862 Query: 182 RHDFIL 199 RHDFIL Sbjct: 863 RHDFIL 868 >ref|XP_002892952.1| hypothetical protein ARALYDRAFT_889150 [Arabidopsis lyrata subsp. lyrata] gi|297338794|gb|EFH69211.1| hypothetical protein ARALYDRAFT_889150 [Arabidopsis lyrata subsp. lyrata] Length = 1850 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLI++V+ +D + HA HAMELKPYIEEP+ VA +S LDFRP + Sbjct: 810 DILRRLKLIQMVSSRLRRDEIEEKHANLTHAMELKPYIEEPV-FVAATSNVMYLDFRPRI 868 Query: 182 RHDFIL 199 RHDFIL Sbjct: 869 RHDFIL 874 >ref|XP_002521337.1| conserved hypothetical protein [Ricinus communis] gi|223539415|gb|EEF41005.1| conserved hypothetical protein [Ricinus communis] Length = 1854 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/66 (56%), Positives = 47/66 (71%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIRL+ +G + + H +AMEL+PYIEEP+ VA S+ S SLD RP + Sbjct: 789 DILRRLKLIRLIRNGQSGNGVKIHHESIMYAMELRPYIEEPLLVVATSNLS-SLDLRPRI 847 Query: 182 RHDFIL 199 RHDFIL Sbjct: 848 RHDFIL 853 >ref|XP_006303881.1| hypothetical protein CARUB_v10008077mg [Capsella rubella] gi|482572592|gb|EOA36779.1| hypothetical protein CARUB_v10008077mg [Capsella rubella] Length = 1857 Score = 68.9 bits (167), Expect = 7e-10 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLI++V+ D + +A HAMELKPYIEEP+ VA +S SLDFRP + Sbjct: 809 DILRRLKLIQMVSSRVRHDGIEEKYANLTHAMELKPYIEEPV-FVAATSNVMSLDFRPRI 867 Query: 182 RHDFIL 199 RHDFIL Sbjct: 868 RHDFIL 873 >ref|XP_007145384.1| hypothetical protein PHAVU_007G2346001g, partial [Phaseolus vulgaris] gi|593689532|ref|XP_007145385.1| hypothetical protein PHAVU_007G2346001g, partial [Phaseolus vulgaris] gi|561018574|gb|ESW17378.1| hypothetical protein PHAVU_007G2346001g, partial [Phaseolus vulgaris] gi|561018575|gb|ESW17379.1| hypothetical protein PHAVU_007G2346001g, partial [Phaseolus vulgaris] Length = 1306 Score = 67.8 bits (164), Expect = 2e-09 Identities = 37/66 (56%), Positives = 43/66 (65%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLIR+V D +D PH H MEL+PYIEEP+S A S SLD RP + Sbjct: 767 DILRRLKLIRMVTDLQSRDGLKSPHT---HTMELRPYIEEPISNDAVSLNFVSLDLRPRV 823 Query: 182 RHDFIL 199 RHDF L Sbjct: 824 RHDFTL 829 >ref|XP_006391048.1| hypothetical protein EUTSA_v10017997mg [Eutrema salsugineum] gi|557087482|gb|ESQ28334.1| hypothetical protein EUTSA_v10017997mg [Eutrema salsugineum] Length = 1834 Score = 67.8 bits (164), Expect = 2e-09 Identities = 37/66 (56%), Positives = 47/66 (71%) Frame = +2 Query: 2 DILQRLKLIRLVNDGNLQDRSDVPHAIFKHAMELKPYIEEPMSTVAPSSGSGSLDFRPHM 181 DIL+RLKLI++V++ QD + +A H MELKPYIEEP+ V +S SLDFRP + Sbjct: 780 DILRRLKLIQMVSNRPRQDDIEERYANLTHEMELKPYIEEPV-FVPATSNVESLDFRPRI 838 Query: 182 RHDFIL 199 RHDFIL Sbjct: 839 RHDFIL 844