BLASTX nr result
ID: Paeonia25_contig00038724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038724 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD39844.1| hypothetical protein CERSUDRAFT_112111 [Ceriporio... 57 3e-06 gb|EIW59456.1| hypothetical protein TRAVEDRAFT_121273 [Trametes ... 55 1e-05 >gb|EMD39844.1| hypothetical protein CERSUDRAFT_112111 [Ceriporiopsis subvermispora B] Length = 837 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -2 Query: 154 PSTASRSASGNGSIKDSPD--DFNSMGYTLMVAGRRTGKTSFLRLLLDTSNV 5 P TASR A + SPD + + GYTLMVAGRRTGKTSFLRLLLDTS V Sbjct: 25 PGTASRRAPR----RSSPDRREGETTGYTLMVAGRRTGKTSFLRLLLDTSAV 72 >gb|EIW59456.1| hypothetical protein TRAVEDRAFT_121273 [Trametes versicolor FP-101664 SS1] Length = 778 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 97 DFNSMGYTLMVAGRRTGKTSFLRLLLDTSNV 5 D ++ GYTLMVAGRRTGKTSFLRLLLDTSNV Sbjct: 3 DGDTPGYTLMVAGRRTGKTSFLRLLLDTSNV 33