BLASTX nr result
ID: Paeonia25_contig00038571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038571 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38863.1| Zinc finger CCCH domain-containing protein 65 [Mo... 59 5e-07 ref|XP_007203237.1| hypothetical protein PRUPE_ppa001043mg [Prun... 57 3e-06 >gb|EXB38863.1| Zinc finger CCCH domain-containing protein 65 [Morus notabilis] Length = 1064 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/71 (46%), Positives = 41/71 (57%) Frame = +1 Query: 25 MGNSQFETLNHSSTLIPFHTRRRSHLKSETFRTLVRILTHPYDDSHRYLAAHIVPEMLIL 204 M +Q ET+ S L+ F RR HLKSET+RTLVRI + D+S LA H V L Sbjct: 1 MEETQIETVKTSDKLVFFPPHRRRHLKSETYRTLVRIFSQFCDESPSSLATHNVDHELNT 60 Query: 205 NDGGSEVGKAT 237 +GG E G+ T Sbjct: 61 ENGGDEFGQTT 71 >ref|XP_007203237.1| hypothetical protein PRUPE_ppa001043mg [Prunus persica] gi|462398768|gb|EMJ04436.1| hypothetical protein PRUPE_ppa001043mg [Prunus persica] Length = 925 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/79 (41%), Positives = 45/79 (56%) Frame = +1 Query: 25 MGNSQFETLNHSSTLIPFHTRRRSHLKSETFRTLVRILTHPYDDSHRYLAAHIVPEMLIL 204 M + ET S TLI F R HLKS T+R+LVRIL+H Y++S A VP+ L Sbjct: 1 MEEANIETEKPSQTLIAFPPHCRRHLKSGTYRSLVRILSHCYEESQHSAADQNVPQELNQ 60 Query: 205 NDGGSEVGKATRIELLNGI 261 ++G E +AT E+L + Sbjct: 61 DNGSIEPVQATEKEVLENV 79