BLASTX nr result
ID: Paeonia25_contig00038527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038527 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD39172.1| hypothetical protein CERSUDRAFT_104423 [Ceriporio... 63 5e-08 emb|CCM02561.1| predicted protein [Fibroporia radiculosa] 60 3e-07 >gb|EMD39172.1| hypothetical protein CERSUDRAFT_104423 [Ceriporiopsis subvermispora B] Length = 333 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -1 Query: 195 MPPQPGVFALPYASTHKARATTNTEMVDMT-PAYHQSSGASTSRVHG 58 MPPQPGVFALPYASTHK RA T+ +DM+ P +H + A SR+HG Sbjct: 1 MPPQPGVFALPYASTHKTRAPQFTDTIDMSAPYHHHQTAAGPSRLHG 47 >emb|CCM02561.1| predicted protein [Fibroporia radiculosa] Length = 338 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -1 Query: 195 MPPQPGVFALPY-ASTHKARATTNTEMVDMTPAYHQSSGASTSRVHGTNSXXXXXXXXXX 19 MPPQPGVF+LPY + HK RA+ N ++VDM AYH A SR HG+ + Sbjct: 1 MPPQPGVFSLPYPTAVHKTRASANADVVDMAAAYHSQPTAGPSRNHGSQAEDPKREKRRR 60 Query: 18 EIAGKL 1 E+ G+L Sbjct: 61 EMVGRL 66