BLASTX nr result
ID: Paeonia25_contig00038503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038503 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315018.2| hypothetical protein POPTR_0010s16960g [Popu... 56 5e-06 >ref|XP_002315018.2| hypothetical protein POPTR_0010s16960g [Populus trichocarpa] gi|550329986|gb|EEF01189.2| hypothetical protein POPTR_0010s16960g [Populus trichocarpa] Length = 426 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 3 IYLKEQNVKLNLIRFKEYLTKAYNKAKNFMDKHG 104 IYLKEQNVK++LIRF+EYL +AY KAK FM+K G Sbjct: 391 IYLKEQNVKIDLIRFREYLKEAYKKAKEFMEKEG 424