BLASTX nr result
ID: Paeonia25_contig00037201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037201 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273894.1| PREDICTED: UPF0503 protein At3g09070, chloro... 68 1e-09 gb|EXB89951.1| hypothetical protein L484_023603 [Morus notabilis] 65 1e-08 ref|XP_006429302.1| hypothetical protein CICLE_v10011239mg [Citr... 64 2e-08 ref|XP_007026790.1| Uncharacterized protein TCM_021761 [Theobrom... 64 2e-08 ref|XP_006363060.1| PREDICTED: UPF0503 protein At3g09070, chloro... 63 4e-08 ref|XP_007208047.1| hypothetical protein PRUPE_ppa002341mg [Prun... 63 5e-08 ref|XP_006480961.1| PREDICTED: UPF0503 protein At3g09070, chloro... 62 6e-08 ref|XP_006573340.1| PREDICTED: UPF0503 protein At3g09070, chloro... 62 8e-08 ref|XP_004137734.1| PREDICTED: UPF0503 protein At3g09070, chloro... 62 8e-08 ref|XP_004246848.1| PREDICTED: UPF0503 protein At3g09070, chloro... 62 1e-07 ref|XP_006576566.1| PREDICTED: UPF0503 protein At3g09070, chloro... 61 2e-07 ref|XP_002534570.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002308207.2| glycine-rich family protein [Populus trichoc... 60 3e-07 ref|XP_004302647.1| PREDICTED: UPF0503 protein At3g09070, chloro... 60 3e-07 ref|XP_007133977.1| hypothetical protein PHAVU_010G008500g [Phas... 59 5e-07 ref|XP_002322958.1| hypothetical protein POPTR_0016s11900g [Popu... 58 1e-06 gb|EYU41837.1| hypothetical protein MIMGU_mgv1a002573mg [Mimulus... 56 5e-06 ref|XP_003632180.1| PREDICTED: UPF0503 protein At3g09070, chloro... 56 6e-06 emb|CAN79178.1| hypothetical protein VITISV_016729 [Vitis vinifera] 56 6e-06 >ref|XP_002273894.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Vitis vinifera] Length = 663 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTP+RS RR SGK++P+N+HSIARSVLRLY Sbjct: 625 DNGLLRFYLTPLRSSRRGGSGKTRPSNSHSIARSVLRLY 663 >gb|EXB89951.1| hypothetical protein L484_023603 [Morus notabilis] Length = 656 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 +NGLLRFYLTPMRS RR +GKS+ N AHSIARSVLRLY Sbjct: 618 ENGLLRFYLTPMRSSRRGGNGKSRYNQAHSIARSVLRLY 656 >ref|XP_006429302.1| hypothetical protein CICLE_v10011239mg [Citrus clementina] gi|557531359|gb|ESR42542.1| hypothetical protein CICLE_v10011239mg [Citrus clementina] Length = 670 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 +NGLLRFYLTPMR RR SGK++ N+AHSIARSVLRLY Sbjct: 632 ENGLLRFYLTPMRGSRRGGSGKTRSNHAHSIARSVLRLY 670 >ref|XP_007026790.1| Uncharacterized protein TCM_021761 [Theobroma cacao] gi|508715395|gb|EOY07292.1| Uncharacterized protein TCM_021761 [Theobroma cacao] Length = 675 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 +NGLLRFYLTP+RS RR SGKS+ ++AHSIARSVLRLY Sbjct: 637 ENGLLRFYLTPLRSSRRGGSGKSRASHAHSIARSVLRLY 675 >ref|XP_006363060.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Solanum tuberosum] Length = 659 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYL PMR RR GKS+PN +HSIARS+LRLY Sbjct: 621 DNGLLRFYLAPMRGSRRGLPGKSRPNGSHSIARSLLRLY 659 >ref|XP_007208047.1| hypothetical protein PRUPE_ppa002341mg [Prunus persica] gi|462403689|gb|EMJ09246.1| hypothetical protein PRUPE_ppa002341mg [Prunus persica] Length = 685 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMRS RS +GK++ ++AHSIARSVLRLY Sbjct: 647 DNGLLRFYLTPMRSSWRSGAGKTRSSHAHSIARSVLRLY 685 >ref|XP_006480961.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Citrus sinensis] Length = 669 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 +NGLLRFYLTPMR RR SGK++ ++AHSIARSVLRLY Sbjct: 631 ENGLLRFYLTPMRGSRRGGSGKTRSSHAHSIARSVLRLY 669 >ref|XP_006573340.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Glycine max] Length = 637 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMR RRS S KS+ N AHSIARSVL LY Sbjct: 599 DNGLLRFYLTPMRGSRRSGSVKSRSNQAHSIARSVLGLY 637 >ref|XP_004137734.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Cucumis sativus] gi|449533170|ref|XP_004173550.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Cucumis sativus] Length = 631 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTP+R RR SGK KP+ A SIARSVLRLY Sbjct: 593 DNGLLRFYLTPLRGSRRGESGKVKPSQAQSIARSVLRLY 631 >ref|XP_004246848.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Solanum lycopersicum] Length = 659 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYL PMR RR GKS+PN +HSIARS+ RLY Sbjct: 621 DNGLLRFYLAPMRGSRRGLPGKSRPNGSHSIARSLFRLY 659 >ref|XP_006576566.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Glycine max] Length = 272 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMR RR+ S KS+ N AHSIARSVL LY Sbjct: 234 DNGLLRFYLTPMRGSRRNGSVKSRSNQAHSIARSVLGLY 272 >ref|XP_002534570.1| conserved hypothetical protein [Ricinus communis] gi|223525005|gb|EEF27813.1| conserved hypothetical protein [Ricinus communis] Length = 676 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMR RR GKSK ++A SIARSVLRLY Sbjct: 638 DNGLLRFYLTPMRGSRRGGWGKSKSSHAQSIARSVLRLY 676 >ref|XP_002308207.2| glycine-rich family protein [Populus trichocarpa] gi|550335887|gb|EEE91730.2| glycine-rich family protein [Populus trichocarpa] Length = 683 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTP+R+ RR+ GKSK ++A SIARSVLRLY Sbjct: 645 DNGLLRFYLTPLRNSRRNGWGKSKSSHAQSIARSVLRLY 683 >ref|XP_004302647.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 698 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSA-SGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMR+ RS +GKS+ N+AHSIARSVLRLY Sbjct: 659 DNGLLRFYLTPMRNSWRSGGAGKSRSNHAHSIARSVLRLY 698 >ref|XP_007133977.1| hypothetical protein PHAVU_010G008500g [Phaseolus vulgaris] gi|561007022|gb|ESW05971.1| hypothetical protein PHAVU_010G008500g [Phaseolus vulgaris] Length = 649 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMR RR+ S KS+ N HSIARSVL LY Sbjct: 611 DNGLLRFYLTPMRGSRRNGSVKSRSNQTHSIARSVLGLY 649 >ref|XP_002322958.1| hypothetical protein POPTR_0016s11900g [Populus trichocarpa] gi|222867588|gb|EEF04719.1| hypothetical protein POPTR_0016s11900g [Populus trichocarpa] Length = 628 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 +NGLLRFYLTP+R+ RR+ GKSK + A SIARSVLRLY Sbjct: 590 ENGLLRFYLTPLRNSRRNGWGKSKSSQAQSIARSVLRLY 628 >gb|EYU41837.1| hypothetical protein MIMGU_mgv1a002573mg [Mimulus guttatus] Length = 657 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTPMR RR G KP N++SIARSVLRLY Sbjct: 621 DNGLLRFYLTPMRGSRRGGIG--KPTNSNSIARSVLRLY 657 >ref|XP_003632180.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic [Vitis vinifera] Length = 292 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTP+R+ RRS SG+S+ N+ SIA SVL+LY Sbjct: 254 DNGLLRFYLTPLRTSRRSKSGQSRLKNSPSIAGSVLKLY 292 >emb|CAN79178.1| hypothetical protein VITISV_016729 [Vitis vinifera] Length = 603 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 313 DNGLLRFYLTPMRSIRRSASGKSKPNNAHSIARSVLRLY 197 DNGLLRFYLTP+R+ RRS SG+S+ N+ SIA SVL+LY Sbjct: 565 DNGLLRFYLTPLRTSRRSKSGQSRLKNSPSIAGSVLKLY 603