BLASTX nr result
ID: Paeonia25_contig00036985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036985 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL99114.1| predicted protein [Fibroporia radiculosa] 57 4e-06 >emb|CCL99114.1| predicted protein [Fibroporia radiculosa] Length = 2836 Score = 56.6 bits (135), Expect = 4e-06 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 5/62 (8%) Frame = -2 Query: 196 TTSMAAPPGYGP-DPRNPFAQN---YAQPSQQYP-SNDFSDSYDSRNASTVPLASAAVYD 32 ++ MAA P YG DP+NPF+ + Y QP +QY +D +D+Y SRNAS+VPL +AA YD Sbjct: 353 SSGMAARPEYGASDPQNPFSNHPSPYGQPLRQYSVDSDPNDAYASRNASSVPLTNAAYYD 412 Query: 31 EQ 26 Q Sbjct: 413 GQ 414