BLASTX nr result
ID: Paeonia25_contig00036674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036674 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 69 7e-10 ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago ... 60 2e-07 ref|XP_002264608.2| PREDICTED: uncharacterized protein LOC100250... 59 9e-07 ref|XP_002531080.1| nutrient reservoir, putative [Ricinus commun... 59 9e-07 ref|XP_003629636.1| hypothetical protein MTR_8g083380 [Medicago ... 50 2e-06 ref|XP_003629606.1| hypothetical protein MTR_8g081560 [Medicago ... 50 2e-06 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/65 (55%), Positives = 40/65 (61%) Frame = +2 Query: 50 YPGGGNGKQRDIAGGPENFKVGSFHLWKNLAYFPVAMFPDRNRSKLVLLSMHHVLELISS 229 YPGGGNGKQRDIA K F K+L YFPVA+F +RN +LLSMHHV ISS Sbjct: 7 YPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTFISS 66 Query: 230 LGKIP 244 P Sbjct: 67 FNNPP 71 >ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago truncatula] gi|355490704|gb|AES71907.1| hypothetical protein MTR_3g084030 [Medicago truncatula] Length = 749 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -2 Query: 120 KDPTLKFSGPPAMSRCFPFPPPGYEKKAITDDTDTLAKER 1 ++ TL SG AMSRCFPFPPPGYEKK+ TDD D L KER Sbjct: 17 QEDTLGISGFCAMSRCFPFPPPGYEKKSRTDDVDLLKKER 56 >ref|XP_002264608.2| PREDICTED: uncharacterized protein LOC100250375 [Vitis vinifera] Length = 542 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/74 (43%), Positives = 36/74 (48%) Frame = -2 Query: 222 MSSRTWCMDRSTSLDLFLSGNIATGK*ARFFHRWKDPTLKFSGPPAMSRCFPFPPPGYEK 43 M++ +WCMDRS D AMSRCFPFPPPGYEK Sbjct: 1 MNAGSWCMDRSIVADFC----------------------------AMSRCFPFPPPGYEK 32 Query: 42 KAITDDTDTLAKER 1 KA TDD D L KE+ Sbjct: 33 KARTDDADLLKKEK 46 >ref|XP_002531080.1| nutrient reservoir, putative [Ricinus communis] gi|223529326|gb|EEF31294.1| nutrient reservoir, putative [Ricinus communis] Length = 518 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/74 (44%), Positives = 39/74 (52%) Frame = -2 Query: 222 MSSRTWCMDRSTSLDLFLSGNIATGK*ARFFHRWKDPTLKFSGPPAMSRCFPFPPPGYEK 43 M++RTWCMD+S LSG++ MSRCFPFP PGYEK Sbjct: 1 MTARTWCMDKS-----ILSGSL-----------------------EMSRCFPFPRPGYEK 32 Query: 42 KAITDDTDTLAKER 1 K TDDTD L KE+ Sbjct: 33 KPRTDDTDLLKKEK 46 >ref|XP_003629636.1| hypothetical protein MTR_8g083380 [Medicago truncatula] gi|355523658|gb|AET04112.1| hypothetical protein MTR_8g083380 [Medicago truncatula] Length = 134 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -2 Query: 123 WKDPTLK--FSGPPAMSRCFPFPPPGYEKKAITDDTDTL 13 W P L+ SG AMSRCFPFPPPGYEKK TD+ D L Sbjct: 10 WFVPFLEQCISGFCAMSRCFPFPPPGYEKKTRTDEVDLL 48 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 208 MVHGQEHKFGSVPVWEHC 155 MVHGQEH VP E C Sbjct: 1 MVHGQEHSCWFVPFLEQC 18 >ref|XP_003629606.1| hypothetical protein MTR_8g081560 [Medicago truncatula] gi|355523628|gb|AET04082.1| hypothetical protein MTR_8g081560 [Medicago truncatula] Length = 134 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -2 Query: 123 WKDPTLK--FSGPPAMSRCFPFPPPGYEKKAITDDTDTL 13 W P L+ SG AMSRCFPFPPPGYEKK TD+ D L Sbjct: 10 WFVPFLEQCISGFCAMSRCFPFPPPGYEKKTRTDEVDLL 48 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 208 MVHGQEHKFGSVPVWEHC 155 MVHGQEH VP E C Sbjct: 1 MVHGQEHSCWFVPFLEQC 18