BLASTX nr result
ID: Paeonia25_contig00036629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036629 (635 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL99421.1| predicted protein [Fibroporia radiculosa] 64 4e-08 ref|XP_007315980.1| hypothetical protein SERLADRAFT_462093 [Serp... 60 4e-07 gb|EIW76101.1| hypothetical protein CONPUDRAFT_139557 [Coniophor... 58 2e-06 ref|XP_007391739.1| hypothetical protein PHACADRAFT_87350 [Phane... 57 4e-06 >emb|CCL99421.1| predicted protein [Fibroporia radiculosa] Length = 330 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/51 (56%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = -2 Query: 634 THTGETPHKCPYAGCDRSFKDPAAKSRHMVKEHGHV-SKPRKTRMQSGEPS 485 THTGE PHKCPY GC+ FKDPA + RHM H HV S+ +K R G S Sbjct: 272 THTGEAPHKCPYPGCEEFFKDPARRHRHMKAVHHHVSSRSKKNRKDLGMSS 322 >ref|XP_007315980.1| hypothetical protein SERLADRAFT_462093 [Serpula lacrymans var. lacrymans S7.9] gi|336364697|gb|EGN93052.1| hypothetical protein SERLA73DRAFT_190204 [Serpula lacrymans var. lacrymans S7.3] gi|336386743|gb|EGO27889.1| hypothetical protein SERLADRAFT_462093 [Serpula lacrymans var. lacrymans S7.9] Length = 516 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -2 Query: 631 HTGETPHKCPYAGCDRSFKDPAAKSRHMVKEHGHVSKPRKTRMQSGE 491 HTG TPH+C Y GC SFKDPA + RHMV+EHG+V + K + + G+ Sbjct: 449 HTGSTPHECRY-GCGMSFKDPARRHRHMVEEHGYVPRQSKRKHKVGQ 494 >gb|EIW76101.1| hypothetical protein CONPUDRAFT_139557 [Coniophora puteana RWD-64-598 SS2] Length = 283 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -2 Query: 631 HTGETPHKCPYAGCDRSFKDPAAKSRHMVKEHGHVSKPRKTRMQS 497 HTG TPH+C Y GC +FKDPA + RHMV+EHG++ + K + +S Sbjct: 239 HTGSTPHECRY-GCGMAFKDPARRHRHMVEEHGYIPRQSKKKHKS 282 >ref|XP_007391739.1| hypothetical protein PHACADRAFT_87350 [Phanerochaete carnosa HHB-10118-sp] gi|409049691|gb|EKM59168.1| hypothetical protein PHACADRAFT_87350 [Phanerochaete carnosa HHB-10118-sp] Length = 115 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -2 Query: 631 HTGETPHKCPYAGCDRSFKDPAAKSRHMVKEHGHVSKPRKTRM-QSG 494 +TG+TPH+CPY C+ +F DPA + RHM H HV R+T+ QSG Sbjct: 53 NTGDTPHRCPYPNCNATFGDPARRHRHMKSAHNHVPSKRRTQADQSG 99