BLASTX nr result
ID: Paeonia25_contig00036596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036596 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279284.1| PREDICTED: uncharacterized protein LOC100266... 57 4e-06 >ref|XP_002279284.1| PREDICTED: uncharacterized protein LOC100266100 [Vitis vinifera] Length = 190 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 113 AAATSSICNSNLIHGSRKQNPWHPRLFLGAGHRILD 6 AA+ +C++NLIH SRK++PWHP+LF G GH+ILD Sbjct: 3 AASLLCLCDTNLIHSSRKESPWHPKLFPGVGHKILD 38