BLASTX nr result
ID: Paeonia25_contig00036511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036511 (652 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD39729.1| hypothetical protein CERSUDRAFT_150401 [Ceriporio... 57 4e-06 >gb|EMD39729.1| hypothetical protein CERSUDRAFT_150401 [Ceriporiopsis subvermispora B] Length = 922 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -3 Query: 146 SLGRSPDALVPERRPRLCHSLHRERNSFLSLAADAKHIYSGSQGDDI 6 SL R DA E +PRL H+LH+E S LSLAAD+KHI+SGSQG+DI Sbjct: 9 SLSRPTDA---ELKPRLRHTLHQEGTSVLSLAADSKHIFSGSQGEDI 52